BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J20 (547 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 46 8e-07 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 42 1e-05 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 42 2e-05 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 42 2e-05 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 27 0.40 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 26 0.93 AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical prote... 25 1.2 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 25 1.2 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 25 1.6 AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 23 5.0 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 8.7 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 23 8.7 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 46.0 bits (104), Expect = 8e-07 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 3/101 (2%) Frame = +2 Query: 128 KSRLGFPHRXXXXXXXXXXXXXQMFVIVTP--VKTGMVLPSIDMS-TMKARYACRWSVCF 298 ++ GFP R Q + I+TP KT D + T R+ + Sbjct: 594 EAHCGFPDRLILPKGWTSGMPMQFYFIITPYTAKTYEQGYQYDKTFTCGVESGMRF---Y 650 Query: 299 DTMPLGFPFDREIYMPTFFTNNMKFTDVQVYRKDLSTMSNT 421 D++P G+PFDR I F+T NM F DV ++ D M+ T Sbjct: 651 DSLPFGYPFDRVINFNYFYTKNMYFKDVFIFHNDEMKMNQT 691 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 41.9 bits (94), Expect = 1e-05 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 3/99 (3%) Frame = +2 Query: 128 KSRLGFPHRXXXXXXXXXXXXXQMFVIVTP--VKTGMVLPSIDMS-TMKARYACRWSVCF 298 ++ GFP R Q + I+TP KT D + T R+ + Sbjct: 594 EAHCGFPDRLILPKGWTSGMPMQFYFIITPYTAKTYEQGYQYDKTFTCGVESGMRF---Y 650 Query: 299 DTMPLGFPFDREIYMPTFFTNNMKFTDVQVYRKDLSTMS 415 D++P G+PFDR I F+T NM F DV ++ + M+ Sbjct: 651 DSLPFGYPFDRVINFNYFYTKNMYFKDVFIFHTEEMKMN 689 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 41.5 bits (93), Expect = 2e-05 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 3/99 (3%) Frame = +2 Query: 128 KSRLGFPHRXXXXXXXXXXXXXQMFVIVTP--VKTGMVLPSIDMS-TMKARYACRWSVCF 298 ++ GFP R Q + I+TP KT D + T R+ + Sbjct: 594 EAHCGFPDRLILPKGWTSGMPMQFYFIITPYTAKTYEQGYQYDKTFTCGVESGMRF---Y 650 Query: 299 DTMPLGFPFDREIYMPTFFTNNMKFTDVQVYRKDLSTMS 415 D +P G+PFDR I F+T NM F DV ++ + M+ Sbjct: 651 DNLPFGYPFDRVINFNYFYTKNMYFKDVFIFHTEEMKMN 689 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 41.5 bits (93), Expect = 2e-05 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 3/99 (3%) Frame = +2 Query: 128 KSRLGFPHRXXXXXXXXXXXXXQMFVIVTP--VKTGMVLPSIDMS-TMKARYACRWSVCF 298 ++ GFP R Q + I+TP KT D + T R+ + Sbjct: 594 EAHCGFPDRLILPKGWTSGMPMQFYFIITPYTAKTYEQGYQYDKTFTCGVESGMRF---Y 650 Query: 299 DTMPLGFPFDREIYMPTFFTNNMKFTDVQVYRKDLSTMS 415 D +P G+PFDR I F+T NM F DV ++ + M+ Sbjct: 651 DNLPFGYPFDRVINFNYFYTKNMYFKDVFIFHTEEMKMN 689 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 27.1 bits (57), Expect = 0.40 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -1 Query: 82 ETFFQYVFSPRSLFDNAVHLERAADDV 2 +T++++ P +LFD A+H+ AD V Sbjct: 494 DTYYEFTCPPGTLFDPALHICNWADQV 520 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 25.8 bits (54), Expect = 0.93 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 84 TQLEQVSRASRVGGIRVALAFRT 152 T + V RA R G +RVA AF+T Sbjct: 799 THRKSVQRAHRPGALRVASAFQT 821 >AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical protein protein. Length = 166 Score = 25.4 bits (53), Expect = 1.2 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 220 DGSHDDEHLERQTAEGSE 167 DGS D+EHLE + E +E Sbjct: 72 DGSPDEEHLEEEQEEEAE 89 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 299 DTMPLGFPFDREIYMPTFFTNNMKFT 376 D P+G+PFDR MPT + FT Sbjct: 640 DRRPMGYPFDRR--MPTAVRSLTDFT 663 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 25.0 bits (52), Expect = 1.6 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Frame = -1 Query: 460 FFITISD---MSHIFDG--VRHSR*VLSVYLHVGKLHVVCEESRHINFPI 326 F IT+S MS I DG V+ ++ + VG L +C+E+ + +F + Sbjct: 241 FIITLSIYGLMSQISDGFGVKDIGLAVTAFCSVGLLFYICDEAHYASFNV 290 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.4 bits (48), Expect = 5.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 331 GNLYAYFLHKQHEVY 375 GNL+A F H QH Y Sbjct: 472 GNLFATFTHIQHAPY 486 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 420 VLDIVDKSFLYTCTSVN 370 +L D SF Y CTSV+ Sbjct: 290 ILSRADWSFFYQCTSVD 306 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 22.6 bits (46), Expect = 8.7 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 22 RDARRYRTETVD*KHIGKRFRHNWNRFQ 105 R+A R+ T + HI +RF+H+ +RF+ Sbjct: 63 RNANTVRSFTHEESHIDQRFQHH-HRFR 89 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 574,254 Number of Sequences: 2352 Number of extensions: 11941 Number of successful extensions: 34 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -