BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J18 (550 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL022274-2|CAA18358.1| 329|Caenorhabditis elegans Hypothetical ... 27 6.7 AF016451-13|AAB66007.1| 445|Caenorhabditis elegans Activated in... 27 6.7 >AL022274-2|CAA18358.1| 329|Caenorhabditis elegans Hypothetical protein H24D24.2 protein. Length = 329 Score = 27.5 bits (58), Expect = 6.7 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -3 Query: 521 PGQSHFDSTIWGTK*SSLVFVSFIIATTPRGCILVL 414 P S D+ TK LV V+F+I+TTP G I L Sbjct: 249 PSVSSNDNNDRSTKMVVLVTVTFLISTTPLGIIYFL 284 >AF016451-13|AAB66007.1| 445|Caenorhabditis elegans Activated in blocked unfolded proteinresponse protein 8 protein. Length = 445 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 417 HQNTTPWCGSDYKTYKNQGRLFCAPNC 497 +QNT + Y T NQG CAP C Sbjct: 253 NQNTNTQMYNPYNTNTNQGSANCAPAC 279 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,965,725 Number of Sequences: 27780 Number of extensions: 313714 Number of successful extensions: 778 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -