BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J16 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_08_0033 + 27820563-27823482,27823593-27823996 30 1.8 08_01_0914 + 9010613-9013316,9013537-9013748 30 1.8 06_03_0499 + 21461608-21463427,21463517-21463627,21463867-214641... 28 7.4 12_02_1069 + 25801309-25801433,25802429-25802620,25803130-258031... 27 9.8 06_03_0793 + 24662506-24663512,24664470-24664787,24664996-246653... 27 9.8 01_01_1166 + 9287840-9288040,9289752-9289799,9292166-9292282,929... 27 9.8 >11_08_0033 + 27820563-27823482,27823593-27823996 Length = 1107 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 61 GVTENVSLQDKRCRRSVCGAPEKGFIPFP 147 GV N++L+ R +CG+P G +P P Sbjct: 709 GVFSNITLKSLRGNAGLCGSPRLGLLPCP 737 >08_01_0914 + 9010613-9013316,9013537-9013748 Length = 971 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/44 (31%), Positives = 28/44 (63%) Frame = -1 Query: 635 IHILLFFLYNSIINSLCIVKNTVWHFSAINLK*SVHINEELWIN 504 +H+L+F + ++I+S+C + T + F +K +V NE L++N Sbjct: 656 LHVLIFCIVGTLISSMCCM--TAYCFIKRKMKLNVVDNENLFLN 697 >06_03_0499 + 21461608-21463427,21463517-21463627,21463867-21464143, 21464265-21464353,21464508-21464595,21464698-21464907, 21464985-21465110,21465429-21465620,21466532-21467188 Length = 1189 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -2 Query: 406 TSESGTLVEGFKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQF 260 +S +G + FK+ +++E K + L EDG++++ K DS+ F Sbjct: 599 SSSNGPVEREFKILNLLEFNSKRKRMSVILKDEDGQILLFCKGADSIIF 647 >12_02_1069 + 25801309-25801433,25802429-25802620,25803130-25803159, 25803426-25803500,25803599-25804373,25804549-25804614, 25804746-25804811,25804898-25805140,25805407-25805502 Length = 555 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 391 CRFRSCAPKLRDSSCTHIILQLSSAMILMDSFNQLLMK 504 C F + A + S+CTH QLSSA +L + +K Sbjct: 69 CSF-AVATSISSSTCTHFTPQLSSAHLLSSQLKEKELK 105 >06_03_0793 + 24662506-24663512,24664470-24664787,24664996-24665323, 24665465-24665887,24665960-24666252,24666332-24666605, 24666856-24667358,24667464-24667785,24667875-24668220, 24668339-24668997,24669524-24669625,24669656-24670052, 24670155-24670270,24670360-24670386 Length = 1704 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 442 IILQLSSAMILMDSFNQLLMKFIHNSSL 525 ++ LS A+ +MDS QL MKF+ L Sbjct: 1076 LLENLSVAIFVMDSLRQLAMKFLEREEL 1103 >01_01_1166 + 9287840-9288040,9289752-9289799,9292166-9292282, 9293018-9293700,9295214-9297190,9298330-9298441, 9299848-9299904 Length = 1064 Score = 27.5 bits (58), Expect = 9.8 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = -1 Query: 506 NFIRSWLNESMSIIALDNCNIICVQELSLNLGAHERKRHSCRRFQSL*HSRTSGKEQ*PL 327 NFI N S SI D ++ LS+++G + + SCR L G ++ P+ Sbjct: 592 NFISLLGNYSYSITGHDK-----IRRLSIHVGGGKEQDFSCRNLSHLRSLTILGCKEKPI 646 Query: 326 PLA 318 P+A Sbjct: 647 PIA 649 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,634,204 Number of Sequences: 37544 Number of extensions: 328647 Number of successful extensions: 786 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -