BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J15 (452 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF9 Cluster: Putative uncharacterized protein; n=1; ... 81 1e-14 UniRef50_Q5BBK2 Cluster: Putative uncharacterized protein; n=1; ... 35 0.94 UniRef50_Q5KGK4 Cluster: Putative uncharacterized protein; n=1; ... 34 1.6 UniRef50_A2ECL1 Cluster: Putative uncharacterized protein; n=1; ... 33 2.2 UniRef50_Q17M69 Cluster: Rab gdp/gtp exchange factor; n=1; Aedes... 33 3.8 UniRef50_UPI00006CBD9F Cluster: MIF4G domain containing protein;... 32 6.6 UniRef50_Q9VZG4 Cluster: CG15005-PA; n=2; Sophophora|Rep: CG1500... 32 6.6 UniRef50_UPI000155BFF2 Cluster: PREDICTED: hypothetical protein,... 31 8.7 UniRef50_A4H431 Cluster: 31-O-demethyl-FK506 methyltransferase; ... 31 8.7 >UniRef50_Q5MGF9 Cluster: Putative uncharacterized protein; n=1; Lonomia obliqua|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 88 Score = 80.6 bits (190), Expect = 1e-14 Identities = 38/63 (60%), Positives = 45/63 (71%) Frame = +2 Query: 80 NRVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNPLAR 259 N+VPSDG VI+NPDPFFSQPSNGP+G Y+ PAFVD ++ P K YD+P AR Sbjct: 29 NQVPSDGQ---FVISNPDPFFSQPSNGPNGGYQQPDISPAFVDNSNQYRPQKHYDHPGAR 85 Query: 260 GGK 268 GGK Sbjct: 86 GGK 88 >UniRef50_Q5BBK2 Cluster: Putative uncharacterized protein; n=1; Emericella nidulans|Rep: Putative uncharacterized protein - Emericella nidulans (Aspergillus nidulans) Length = 1458 Score = 34.7 bits (76), Expect = 0.94 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 131 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYP 229 D F QPSNG GN E I P F++ N P+ P Sbjct: 527 DQNFDQPSNG--GNMEDIQESPGFIESNKPDVP 557 >UniRef50_Q5KGK4 Cluster: Putative uncharacterized protein; n=1; Filobasidiella neoformans|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 375 Score = 33.9 bits (74), Expect = 1.6 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +2 Query: 80 NRVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDN 247 N +P+ G + + ++P P ++ PS SG+ +++GP+ VDF+ P P R N Sbjct: 79 NPIPAQGLPEDQIPSDPPPAYT-PSANMSGS-TTVASGPSHVDFSGPPPMPDRIAN 132 >UniRef50_A2ECL1 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 713 Score = 33.5 bits (73), Expect = 2.2 Identities = 15/51 (29%), Positives = 28/51 (54%) Frame = +2 Query: 80 NRVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 232 N + + G + ++ NP + + GP+ + P ++GP ++ N PNYPP Sbjct: 294 NSMQNSGPNYNMGPNNPQNQYPNNNRGPNPIFNP-NSGPGYMQRNPPNYPP 343 >UniRef50_Q17M69 Cluster: Rab gdp/gtp exchange factor; n=1; Aedes aegypti|Rep: Rab gdp/gtp exchange factor - Aedes aegypti (Yellowfever mosquito) Length = 1563 Score = 32.7 bits (71), Expect = 3.8 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 80 NRVPSDGNSDHVVIANPDPFFSQPSNGPSGNYE-PISTGPAFV 205 NRV S+GNSDH P P + PS + P PA V Sbjct: 824 NRVDSNGNSDHNRTETPSPLLNNGGTAPSSKQDSPFYADPADV 866 >UniRef50_UPI00006CBD9F Cluster: MIF4G domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: MIF4G domain containing protein - Tetrahymena thermophila SB210 Length = 1058 Score = 31.9 bits (69), Expect = 6.6 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +2 Query: 80 NRVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNP 250 N P + N+ + AN P P N +GN + P F+ HPN+P + + P Sbjct: 67 NGTPYNNNNMDINNANR-PANLYPLNLNNGNIQQFQQTPPFIQTQHPNFPNQPFIQP 122 >UniRef50_Q9VZG4 Cluster: CG15005-PA; n=2; Sophophora|Rep: CG15005-PA - Drosophila melanogaster (Fruit fly) Length = 750 Score = 31.9 bits (69), Expect = 6.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 125 NPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNP 250 +P P +SQP PS +Y+ + P+ P +P Y+ P Sbjct: 339 HPPPSYSQPPQHPSSSYDQPAQHPSSSYDQPPKHPSSSYEQP 380 >UniRef50_UPI000155BFF2 Cluster: PREDICTED: hypothetical protein, partial; n=2; Mammalia|Rep: PREDICTED: hypothetical protein, partial - Ornithorhynchus anatinus Length = 886 Score = 31.5 bits (68), Expect = 8.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +2 Query: 80 NRVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 232 ++ PS G+S + P F PS+ + P+S P +D P PP Sbjct: 737 SKTPSPGSSSPSAPPSGKPSFGTPSSSRANGSRPLSPAPPALDRPRPPNPP 787 >UniRef50_A4H431 Cluster: 31-O-demethyl-FK506 methyltransferase; n=1; Leishmania braziliensis|Rep: 31-O-demethyl-FK506 methyltransferase - Leishmania braziliensis Length = 353 Score = 31.5 bits (68), Expect = 8.7 Identities = 13/54 (24%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = -2 Query: 301 VLKSLIFMRHLL--PTTGERVVVSLGWIIGMIEIDERRSSAYGFIISARTV*WL 146 + K +++ RH + P TG +V+ +G IG+ + + + +++A + WL Sbjct: 65 IFKDMVYKRHGIDIPVTGSPLVIDVGCNIGLFSMFVLEVNPHAVVVAAEPIPWL 118 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 388,623,633 Number of Sequences: 1657284 Number of extensions: 6968994 Number of successful extensions: 16221 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 15738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16191 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 23511729640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -