BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J13 (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 87 1e-19 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 86 3e-19 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 3.2 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 3.2 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 4.2 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 4.2 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 7.3 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 9.6 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 9.6 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 87.4 bits (207), Expect = 1e-19 Identities = 68/238 (28%), Positives = 120/238 (50%), Gaps = 8/238 (3%) Frame = +2 Query: 2 INGGMFVYALTAAVFHRSDCVGITLPAPYEIYPYFFVDSHVINKAFMMKMTKAATDPVLM 181 +N +F YA + A+ HR D + LP+ ++P +VDS V +A +A P Sbjct: 118 VNPYLFYYAFSVALLHRPDTQNLDLPSFIHVFPDKYVDSQVFARA----REEAHIVP--- 170 Query: 182 NYYGIKVTDKSMVVIDWRKGVRRS-LSEDDKYSYFTEDVDLNTYMYYLHMNYPYWMTDEV 358 + S I+ + S L E+ + +Y+ ED+ LN + ++ H+ YP+ E+ Sbjct: 171 --------EGSRTPIEIPQDFTASDLDEEHRVAYWREDIGLNLHHWHWHLVYPFEGAREI 222 Query: 359 YGLNKERQGEILMYANSQLLARLRMERLSHKMCD-IKMFMWNEPVKNGYWPKI-RLPNGD 532 ++K R+GEI Y + Q++AR +ERL + + +K+ W EP+ Y+PK+ L Sbjct: 223 --VDKNRRGEIFYYMHQQIIARFNIERLCNGLKRVVKLSNWREPLPEAYFPKLDSLVASR 280 Query: 533 EMPVRQNNFVP--VTSENLKLKMLLDDVEQ---MIREGILTGKIERRDGTMINLKKPE 691 P R N VP + E ++++ LDD+++ I + I +G + +G I L + E Sbjct: 281 TWPARPVNQVPRDLNREVDQIRLSLDDMDRWRDRIYDAIHSGVVRGDNGQNIPLTEFE 338 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 85.8 bits (203), Expect = 3e-19 Identities = 66/211 (31%), Positives = 105/211 (49%), Gaps = 3/211 (1%) Frame = +2 Query: 2 INGGMFVYALTAAVFHRSDCVGITLPAPYEIYPYFFVDSHVINKAFMMKMTKAATDPVLM 181 +N +F YAL+ A+ HR D I LP+ E +P +VDS V KA + AT Sbjct: 118 VNPYLFSYALSVAILHRQDTQDIDLPSFIESFPDKYVDSKVFAKA-----REEAT----- 167 Query: 182 NYYGIKVTDKSMVVIDWRKGVRRS-LSEDDKYSYFTEDVDLNTYMYYLHMNYPYWMTDEV 358 V + S I+ + S L E+ + +YF ED+ +N + ++ H+ YP+ EV Sbjct: 168 -----VVPEGSRTPIEIPRDYTASDLEEEHRLAYFREDLGINLHHWHWHLVYPFEAAREV 222 Query: 359 YGLNKERQGEILMYANSQLLARLRMERLSHKMCDIKMFM-WNEPVKNGYWPKI-RLPNGD 532 + K R+GE+ Y + Q++AR ERL +K+ F +NE +K Y+PK+ L + Sbjct: 223 --VAKNRRGELFYYMHQQIIARYNFERLCNKLKRATRFNDFNEAIKEAYFPKLDSLVSSR 280 Query: 533 EMPVRQNNFVPVTSENLKLKMLLDDVEQMIR 625 P R N + N ++ + DVE + R Sbjct: 281 AWPSRVAN-QKLRDLNREVDQIKQDVEDLKR 310 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +3 Query: 429 EWNVYHTKCATLKCSCGMNPSRTVIGLRSACPMEMRCQFV 548 +W C T C G N T+ + CP M+ + V Sbjct: 685 QWTSSDNPCTTCFCENGNNKCFTMECPQVTCPDNMKLEKV 724 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 543 TGISSPLGRRILGQ*PFLTGSFHMNILMSHI 451 TG+ + G + + LT +FH NIL I Sbjct: 113 TGLLTSAGPKWQNRRKILTPAFHFNILQEFI 143 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 543 TGISSPLGRRILGQ*PFLTGSFHMNILMSHI 451 TG+ + G + + LT +FH NIL I Sbjct: 113 TGLLTSRGPKWQNRRKILTPAFHFNILQEFI 143 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 245 RRSLSEDDKYSYFTEDVDLNTYMYYLHMN 331 R S + KY+Y V L YM Y+ N Sbjct: 36 RHSFYKIYKYTYNIVAVSLTAYMVYITTN 64 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 455 CDIKMFMWNEPVKN 496 C++ M MWN P +N Sbjct: 433 CNVLMEMWNIPREN 446 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 444 HTKCATLKCSCGMNPSRTVIGLRS 515 +T A ++CS NP+ +I +RS Sbjct: 37 NTTGAVVECSAHGNPTPDIIWVRS 60 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 293 VDLNTYMYYLHMNYP 337 V LN Y ++L + YP Sbjct: 25 VPLNPYQFFLAVQYP 39 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,314 Number of Sequences: 336 Number of extensions: 3226 Number of successful extensions: 17 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -