BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J13 (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizo... 28 1.5 SPBC29A10.07 |||nucleoporin Pom152|Schizosaccharomyces pombe|chr... 27 1.9 SPCC1840.06 |atp5||F0-ATPase delta subunit|Schizosaccharomyces p... 26 4.5 >SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizosaccharomyces pombe|chr 2|||Manual Length = 778 Score = 27.9 bits (59), Expect = 1.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 241 SFTPVDDNHTLISNFYPVIVHKHRVGGSFSHLHHEGF 131 S P+ N T++ N+Y ++ KH +F H H E + Sbjct: 328 SDNPITANSTIL-NYYDIVTIKHMGTNAFLHSHPEKY 363 >SPBC29A10.07 |||nucleoporin Pom152|Schizosaccharomyces pombe|chr 2|||Manual Length = 1250 Score = 27.5 bits (58), Expect = 1.9 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 253 RAAHSFTPVD-DNHTLISNFYPVIVHK 176 R AH +T D ++H+L N Y V VH+ Sbjct: 401 RFAHGYTEADGESHSLPENVYSVFVHQ 427 >SPCC1840.06 |atp5||F0-ATPase delta subunit|Schizosaccharomyces pombe|chr 3|||Manual Length = 216 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 241 SFTPVDDNHTLISNFYPVIVHKHRV 167 S T + N L+ NFY V++ HR+ Sbjct: 97 SLTQMTGNEPLLKNFYNVLLDNHRL 121 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,648,051 Number of Sequences: 5004 Number of extensions: 52936 Number of successful extensions: 149 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -