BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J12 (280 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 24 0.40 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 0.70 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 0.70 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 0.70 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 1.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 1.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 1.6 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 20 6.5 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 20 6.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 20 6.5 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 19 8.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 19 8.6 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 19 8.6 AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. 19 8.6 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 23.8 bits (49), Expect = 0.40 Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -2 Query: 129 LEIWMFGCMV-VFLSYHDSLLEEVL 58 L++WM GCM+ VF + + ++ +VL Sbjct: 262 LDVWMAGCMMFVFAALGEFVVVKVL 286 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 0.70 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 24 VDAKTKPCFYL*VPLQG 74 +DA TKPC + P QG Sbjct: 294 IDANTKPCTWAARPWQG 310 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 0.70 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 24 VDAKTKPCFYL*VPLQG 74 +DA TKPC + P QG Sbjct: 294 IDANTKPCTWAARPWQG 310 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 0.70 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 24 VDAKTKPCFYL*VPLQG 74 +DA TKPC + P QG Sbjct: 294 IDANTKPCTWAARPWQG 310 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.2 bits (45), Expect = 1.2 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 94 KDYHAPKHPDLEKI--PNLQVIKAMQSLKSRGYVKEQ 198 KD P + KI PN+ +IK L G V E+ Sbjct: 242 KDAKVPIIVAINKIDKPNIDIIKVQYELAKHGIVIEE 278 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 1.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 266 CRKILRYSIPSFVK 225 C +LR +PSFVK Sbjct: 146 CTAVLRCVVPSFVK 159 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 1.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 266 CRKILRYSIPSFVK 225 C +LR +PSFVK Sbjct: 146 CTAVLRCVVPSFVK 159 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 19.8 bits (39), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 141 VRDLLEIWMFG 109 V DLL W+FG Sbjct: 84 VNDLLGYWVFG 94 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 19.8 bits (39), Expect = 6.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 263 RKILRYSIPSFVKYQ 219 RKIL Y++ + KYQ Sbjct: 386 RKILGYNLEAASKYQ 400 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 19.8 bits (39), Expect = 6.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 263 RKILRYSIPSFVKYQ 219 RKIL Y++ + KYQ Sbjct: 386 RKILGYNLEAASKYQ 400 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 19.4 bits (38), Expect = 8.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 263 RKILRYSIPSFVKYQ 219 RK+L + S VKYQ Sbjct: 385 RKVLGFGYESNVKYQ 399 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 19.4 bits (38), Expect = 8.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 263 RKILRYSIPSFVKYQ 219 RK+L + S VKYQ Sbjct: 385 RKVLGFGYESNVKYQ 399 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 19.4 bits (38), Expect = 8.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 263 RKILRYSIPSFVKYQ 219 RK+L + S VKYQ Sbjct: 11 RKVLGFGYESNVKYQ 25 >AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. Length = 122 Score = 19.4 bits (38), Expect = 8.6 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +1 Query: 22 MLMPKQNRVSIYEYLFKEGVMVAKKDY 102 +L+P +N S Y K+G + K + Sbjct: 3 ILIPHRNPASANYYENKDGARIVKASH 29 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,978 Number of Sequences: 438 Number of extensions: 1269 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 5369883 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -