BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J11 (380 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14320.1 68417.m02206 60S ribosomal protein L36a/L44 (RPL36aB) 115 9e-27 At3g23390.1 68416.m02949 60S ribosomal protein L36a/L44 (RPL36aA... 115 9e-27 At3g14050.1 68416.m01773 RelA/SpoT protein, putative (RSH2) near... 30 0.60 At5g53800.1 68418.m06685 expressed protein 28 1.8 At5g51230.2 68418.m06353 embryonic flower 2 (EMF2) identical to ... 26 7.4 At5g51230.1 68418.m06352 embryonic flower 2 (EMF2) identical to ... 26 7.4 At5g49230.1 68418.m06094 drought-responsive family protein simil... 26 7.4 >At4g14320.1 68417.m02206 60S ribosomal protein L36a/L44 (RPL36aB) Length = 105 Score = 115 bits (277), Expect = 9e-27 Identities = 55/101 (54%), Positives = 65/101 (64%), Gaps = 2/101 (1%) Frame = +1 Query: 22 MVNVPKQRRTYXXXXX--XXXXXXXSQYKKSKERHAAQGRRRYDRKQQGYGGQSKPIFXX 195 MVN+PK + TY +QYKK K+ AAQG+RRYDRKQ GYGGQ+KP+F Sbjct: 1 MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHK 60 Query: 196 XXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 318 IVLRL+C CK SQ +KRCKHFE+GGDKK KG Sbjct: 61 KAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101 >At3g23390.1 68416.m02949 60S ribosomal protein L36a/L44 (RPL36aA) similar to ribosomal protein L41 GB:AAA34366 from [Candida maltosa] Length = 105 Score = 115 bits (277), Expect = 9e-27 Identities = 55/101 (54%), Positives = 65/101 (64%), Gaps = 2/101 (1%) Frame = +1 Query: 22 MVNVPKQRRTYXXXXX--XXXXXXXSQYKKSKERHAAQGRRRYDRKQQGYGGQSKPIFXX 195 MVN+PK + TY +QYKK K+ AAQG+RRYDRKQ GYGGQ+KP+F Sbjct: 1 MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHK 60 Query: 196 XXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 318 IVLRL+C CK SQ +KRCKHFE+GGDKK KG Sbjct: 61 KAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101 >At3g14050.1 68416.m01773 RelA/SpoT protein, putative (RSH2) nearly identical to RelA/SpoT homolog RSH2 [Arabidopsis thaliana] GI:7141306; contains Pfam profiles PF01966: HD domain, PF04607: Region found in RelA / SpoT proteins Length = 709 Score = 29.9 bits (64), Expect = 0.60 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 311 LFLSPPSSKCLQRFRATCDLTLQSAHSRRST 219 L+ SPPSS C + +CDL L S S S+ Sbjct: 9 LYASPPSSVCSTPHQISCDLDLTSRSSSTSS 39 >At5g53800.1 68418.m06685 expressed protein Length = 351 Score = 28.3 bits (60), Expect = 1.8 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +1 Query: 10 TDVKMVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQGRRRYDRKQQ 159 +D K ++RR Y S+Y S+E + RRR RK++ Sbjct: 89 SDRKSSRSRRRRRDYSSSSSDSESESESEYSDSEESESEDERRRRKRKRK 138 >At5g51230.2 68418.m06353 embryonic flower 2 (EMF2) identical to embryonic flower 2 [Arabidopsis thaliana] GI:14276050; supporting cDNA gi|14276049|dbj|AB053171.1| Length = 626 Score = 26.2 bits (55), Expect = 7.4 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 250 VRSQVALKRCKHFELGGDKKRKGQMIQF 333 +R+ + L+RC H+++ KR+ QM F Sbjct: 60 IRNPLFLQRCLHYKIEAKHKRRIQMTVF 87 >At5g51230.1 68418.m06352 embryonic flower 2 (EMF2) identical to embryonic flower 2 [Arabidopsis thaliana] GI:14276050; supporting cDNA gi|14276049|dbj|AB053171.1| Length = 631 Score = 26.2 bits (55), Expect = 7.4 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 250 VRSQVALKRCKHFELGGDKKRKGQMIQF 333 +R+ + L+RC H+++ KR+ QM F Sbjct: 60 IRNPLFLQRCLHYKIEAKHKRRIQMTVF 87 >At5g49230.1 68418.m06094 drought-responsive family protein similar to drought-induced mRNA, Di19 [Arabidopsis thaliana] gi|469110|emb|CAA55321 Length = 211 Score = 26.2 bits (55), Expect = 7.4 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -1 Query: 332 NWIICPFLFLSPPSSKCLQRFRATCDLTL 246 +WI CP +F S PSS+ R+++ DL L Sbjct: 5 SWINCPPVFSSSPSSR---RYQSRSDLYL 30 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,910,504 Number of Sequences: 28952 Number of extensions: 120091 Number of successful extensions: 299 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 297 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 527724392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -