BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J10 (586 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 27 0.45 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 7.3 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 27.1 bits (57), Expect = 0.45 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 461 LDLYVLA-VLWPIMARCTVVAKRSLQYLVPF 550 +D+Y VLW +++RCTV +Y +PF Sbjct: 314 IDVYACGLVLWELVSRCTVHGGPVDEYRLPF 344 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.0 bits (47), Expect = 7.3 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 443 VILRIPENYPRSPIRAPSIVCQAFLPTDVARPL 345 +I+R+ N ++ IR+ + P D+AR L Sbjct: 357 LIIRLRHNVIKTAIRSIGLAYSRISPQDIARKL 389 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 608,349 Number of Sequences: 2352 Number of extensions: 12251 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -