Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0003_J08
         (553 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakini...    25   1.7  

>AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakinin
           GPCR protein.
          Length = 634

 Score = 25.0 bits (52), Expect = 1.7
 Identities = 15/61 (24%), Positives = 26/61 (42%), Gaps = 1/61 (1%)
 Frame = +1

Query: 175 GIGLSQTNDRFCTNRIHQTPATFIRSSIHLISRYVNV-FVLFE*ILIHWAGFNLLNVFYY 351
           G G  Q    +C     +T    +R   H  ++ + + FV+     + WA  ++LN  Y 
Sbjct: 432 GSGADQRT-HYCGGAGCETRPGRLRGFRHFFAKVIRMLFVIIVEFFVCWAPLHILNTVYL 490

Query: 352 Y 354
           Y
Sbjct: 491 Y 491


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 593,568
Number of Sequences: 2352
Number of extensions: 12968
Number of successful extensions: 14
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 51301854
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)