BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J08 (553 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 6.3 AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein ... 21 6.3 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 6.3 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +3 Query: 141 IHPFNRMTSTAGHRSLPNQRPVLYKPHPPDSRDLHQVIDPPYI 269 + P S++ P Q P ++ P S + VI PP I Sbjct: 807 LSPVREKLSSSQPMQPPQQNPYMFLPVSYMSTTMAGVIYPPVI 849 >AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein protein. Length = 87 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 192 NQRPVLYKPHPPDSRD 239 N+ PVL+ P PP + + Sbjct: 45 NRGPVLFPPGPPPNNE 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,738 Number of Sequences: 438 Number of extensions: 3859 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -