BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J06 (592 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0275 - 19079782-19081262,19081803-19082029,19085080-19085099 28 4.8 04_04_0263 + 24030132-24030539,24031575-24031586,24032023-240322... 27 8.5 >06_03_0275 - 19079782-19081262,19081803-19082029,19085080-19085099 Length = 575 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 286 YEFRVKSTCVRRSADLGH*QRTPRLERTCLAAVRPWLP 173 Y++R + + R L RTP L R CL+A+ +LP Sbjct: 167 YKWRCVGSLIGRHHLLQEPTRTPELLRRCLSAINGFLP 204 >04_04_0263 + 24030132-24030539,24031575-24031586,24032023-24032267, 24032380-24032900,24033387-24033877 Length = 558 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/53 (18%), Positives = 25/53 (47%) Frame = +1 Query: 7 WCCGALGGSGLTRHRAFGTDRLNRSMRSLSPSRKNGTSKLSSTIRISMNSTYN 165 WCC G+G + FG + + + +++ +N + + ++R + + N Sbjct: 164 WCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGMSLRNELRGSKN 216 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,571,981 Number of Sequences: 37544 Number of extensions: 304689 Number of successful extensions: 684 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -