BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J06 (592 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 24 3.2 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 23 5.6 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 237 PKSAERRTHVDLTRNSYPPRTPHPARSICI 326 P + +R+ V LT++ PP P R IC+ Sbjct: 466 PDAWKRQQLVLLTKSGKPPGEPSSYRPICL 495 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 23.4 bits (48), Expect = 5.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 16 GALGGSGLTRHRAFGTDRLNR 78 G + G+G TRH A+ T + R Sbjct: 45 GQMQGNGTTRHAAYVTQEIYR 65 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,732 Number of Sequences: 2352 Number of extensions: 12250 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -