BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J04 (547 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0190 - 23442824-23442846,23442891-23442949,23443613-234437... 35 0.049 04_04_1068 + 30552935-30553234,30553424-30553623,30553738-30554122 33 0.15 03_01_0536 - 4020235-4021161,4022760-4022808,4023203-4023267 27 7.4 02_05_0729 - 31271566-31271730,31271799-31271933,31272210-312722... 27 9.8 >04_04_0190 - 23442824-23442846,23442891-23442949,23443613-23443737, 23443767-23443901,23444195-23444301,23444488-23444566, 23444856-23444942,23445045-23445281,23445783-23446128, 23446486-23446694 Length = 468 Score = 34.7 bits (76), Expect = 0.049 Identities = 23/58 (39%), Positives = 29/58 (50%) Frame = -3 Query: 446 SLKFNFSKEASNTLTASSFSSECSSYGPSFKYTLFAMFSVIPCIDFKLDVIEVNEERI 273 +L+F S ASNTL S CS YG FK LF +++ C I NEER+ Sbjct: 48 TLRF-LSPHASNTL-GSFLEDHCSRYGRVFKSHLFCTPTIVSCDQELNHFILQNEERL 103 >04_04_1068 + 30552935-30553234,30553424-30553623,30553738-30554122 Length = 294 Score = 33.1 bits (72), Expect = 0.15 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Frame = +1 Query: 220 DPAHEELLTSLDIPNDDCIRSS----FTSITSNLKSIQGITLNIANKVY-LKEGPYELHS 384 D E L SLD C RS + I +K I+G + +Y + EGP+E+H Sbjct: 52 DGDSEALALSLDQSQGSCFRSREKYLYVQIDVEIKLIEGDSAGTVCTIYTISEGPWEIHD 111 Query: 385 EL 390 E+ Sbjct: 112 EI 113 >03_01_0536 - 4020235-4021161,4022760-4022808,4023203-4023267 Length = 346 Score = 27.5 bits (58), Expect = 7.4 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 449 PSLKFNFSKEASNTLTASSFSSECSSYG 366 PSL ++ A +S SSECSSYG Sbjct: 108 PSLAGSYRARAPGPHATTSSSSECSSYG 135 >02_05_0729 - 31271566-31271730,31271799-31271933,31272210-31272284, 31273003-31273068,31273154-31273222,31273303-31273377, 31273518-31273628,31273947-31274009,31274064-31274453 Length = 382 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 274 IRSSFTSITSNLKSIQGITLNIANKVYLKEGPYELHSELKEDAVKV 411 +RS S TS +KS+ G + + V LHS L+ ++V V Sbjct: 259 LRSKIASATSAIKSVFGQEVQQQDAVMAISESARLHSSLRNESVPV 304 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,233,872 Number of Sequences: 37544 Number of extensions: 179927 Number of successful extensions: 452 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1222086348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -