BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J02 (385 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 208 4e-56 AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like p... 27 0.24 AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like p... 27 0.24 AY341233-1|AAR13797.1| 196|Anopheles gambiae transferrin-like p... 27 0.24 AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like p... 27 0.24 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 1.7 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 23 2.9 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 23 2.9 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 23 3.8 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 23 5.1 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 6.7 AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical prote... 22 8.9 AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory a... 22 8.9 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 208 bits (509), Expect = 4e-56 Identities = 95/112 (84%), Positives = 104/112 (92%) Frame = +2 Query: 35 KRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINEASVYTSFQ 214 +RRNGGR KH RGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDI++ASVY+S+ Sbjct: 3 ERRNGGRCKHNRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYSSYV 62 Query: 215 LPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMARPQNVQRK 370 LPKLYAKLHYCVSCAIHSKVVRNRSK+ RRIRTPP+ +FP+DM R QN QRK Sbjct: 63 LPKLYAKLHYCVSCAIHSKVVRNRSKETRRIRTPPQRSFPKDMNRQQNAQRK 114 >AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 27.1 bits (57), Expect = 0.24 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +2 Query: 59 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINE 190 K G+GH + + N C P+ I N+ + + D NE Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 27.1 bits (57), Expect = 0.24 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +2 Query: 59 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINE 190 K G+GH + + N C P+ I N+ + + D NE Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AY341233-1|AAR13797.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 27.1 bits (57), Expect = 0.24 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +2 Query: 59 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINE 190 K G+GH + + N C P+ I N+ + + D NE Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 27.1 bits (57), Expect = 0.24 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +2 Query: 59 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINE 190 K G+GH + + N C P+ I N+ + + D NE Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 1.7 Identities = 16/75 (21%), Positives = 32/75 (42%) Frame = +2 Query: 101 CARCVPKDKAIKKFVIRNIVEAAAVRDINEASVYTSFQLPKLYAKLHYCVSCAIHSKVVR 280 CA V K + + ++ IR + + DI ASV+ + Y + + + Sbjct: 808 CATTVRKGRKLYQYTIRLPINSPWKEDILIASVFNECRPDAETVAYLYHIRMELICPIPE 867 Query: 281 NRSKKDRRIRTPPKS 325 ++ + R+I P +S Sbjct: 868 EQNTRGRKIYAPEES 882 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.4 bits (48), Expect = 2.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 183 MSLTAAASTIFLITNFLMALSLGTQRAQLVHRTALTW 73 +++ +A ++F + L + S R Q VHR LTW Sbjct: 313 LNMVSATLSLFSVCWALASFSKNV-RLQNVHRLVLTW 348 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 23.4 bits (48), Expect = 2.9 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -2 Query: 237 SFAYSLGSWNEVYTEASFMSLTAAASTIFLITNFLM 130 S +++ +E T+ + L + + +FL T FLM Sbjct: 513 SLGWAVSKKSEAMTDERYSLLASIPAGLFLATTFLM 548 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.0 bits (47), Expect = 3.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 225 CMQNSTTACHARSIAKW 275 C + T+ H SIAKW Sbjct: 182 CQAQNDTSNHVHSIAKW 198 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 22.6 bits (46), Expect = 5.1 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 17 VRNMTRKRRNGGRAKHGRGHVKAVRCTNCARCV 115 VR R+ + G + KAV CTN +C+ Sbjct: 246 VRECQGTNRSSLCIRCGAANHKAVNCTNDVKCL 278 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 322 LGWCTDPPVLLRSVTH 275 LG+C DP LL + H Sbjct: 741 LGFCVDPSSLLSPLNH 756 >AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical protein protein. Length = 126 Score = 21.8 bits (44), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 95 TNCARCVPKDKAIKKFVIRNIVE 163 T+CA+C K K+ + VI +++ Sbjct: 70 TDCAKCSEKQKSGTEKVINYLID 92 >AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory appendage protein SAP-3 protein. Length = 126 Score = 21.8 bits (44), Expect = 8.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 95 TNCARCVPKDKAIKKFVIRNIVE 163 T+CA+C K K+ + VI +++ Sbjct: 70 TDCAKCSEKQKSGTEKVINYLID 92 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 401,385 Number of Sequences: 2352 Number of extensions: 7710 Number of successful extensions: 30 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -