BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I24 (607 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 28 0.96 01_05_0548 + 23149271-23149568,23149766-23149845,23150137-231502... 28 6.6 >03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 Length = 380 Score = 27.9 bits (59), Expect(2) = 0.96 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 502 NGISGNIGLNVDGNTERLVVESWLTNLEVVWVTS 401 NG + + G T+R+++ SWL+ LE+ + T+ Sbjct: 224 NGFTEAPETSNSGQTKRVLLSSWLSTLELAYTTA 257 Score = 21.4 bits (43), Expect(2) = 0.96 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 370 VSGIKLAIVKECD*FLNDNIIDFNADEMKFL 278 VSG ++A+ + L+ N++ + DEM L Sbjct: 298 VSGTRIALGDDGSIALSRNVVVLHVDEMLLL 328 >01_05_0548 + 23149271-23149568,23149766-23149845,23150137-23150223, 23150421-23150729,23150774-23150899,23151977-23152360, 23152603-23152608 Length = 429 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/78 (21%), Positives = 36/78 (46%), Gaps = 5/78 (6%) Frame = +2 Query: 329 LVTFFDYSQFDATNSVFLTK-----KEIKTSYPHNFKVRQPRLNHKPFSVTIDVXSDIAT 493 L F +S F ++++ + + ++KT ++ ++ PRL + S+ DV + + Sbjct: 64 LAAVFSFSSFTSSSNYVIRECLGSVLDLKTVATIDWSMKTPRLQYYTSSMVDDVFTRLGE 123 Query: 494 DAVIKIFLGPKYNDXGFP 547 D +K + Y G P Sbjct: 124 DIKVKPWAHTVYGKNGIP 141 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,137,672 Number of Sequences: 37544 Number of extensions: 295838 Number of successful extensions: 714 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1442939384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -