BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I23 (655 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |S... 28 1.4 SPBC1215.02c |arm1|mdm20|NatB N-acetyltransferase complex non ca... 28 1.4 SPBPJ4664.05 |||conserved fungal protein|Schizosaccharomyces pom... 26 4.1 SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ub... 25 7.2 SPAC3A12.04c |||RNase P and RNase MRP subunit p30 |Schizosacchar... 25 7.2 SPAC1687.20c |mis6||inner centromere protein Mis6|Schizosaccharo... 25 7.2 SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo... 25 7.2 SPAC23H3.08c |bub3||mitotic spindle checkpoint protein Bub3|Schi... 25 9.5 SPAC12B10.13 |||CTLH domain|Schizosaccharomyces pombe|chr 1|||Ma... 25 9.5 SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 25 9.5 >SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |Schizosaccharomyces pombe|chr 2|||Manual Length = 1944 Score = 27.9 bits (59), Expect = 1.4 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = -1 Query: 181 VRASLSDSDVI*VLTDCCRMAV---RAYAHAPRVTNSHTLMNFILFYVRINDVRKRHVYR 11 VR+S+S I L D R+ V RA + V NS LM +FY I D + R V+R Sbjct: 1721 VRSSMSGG--IGFLQDLRRLNVALTRAKSSLYIVGNSKPLMQEDIFYSLIEDAKTRGVWR 1778 Query: 10 D 8 D Sbjct: 1779 D 1779 >SPBC1215.02c |arm1|mdm20|NatB N-acetyltransferase complex non catalytic subunit Arm1|Schizosaccharomyces pombe|chr 2|||Manual Length = 811 Score = 27.9 bits (59), Expect = 1.4 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = -2 Query: 378 RSSNVYPMIDCSFYPMSSLELYRNLLCRTSQSLSIGLR---LVQNSESAKFRHQLDDQRW 208 R++ YP S Y SSL++Y + T + +S+ Q + FR +LD W Sbjct: 480 RATTYYPSSVTSHYINSSLKIYGSNEFETPEMISMAYEDGAYSQIEDMRNFRSRLDHSTW 539 Query: 207 RML 199 + + Sbjct: 540 KSI 542 >SPBPJ4664.05 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 163 Score = 26.2 bits (55), Expect = 4.1 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -2 Query: 411 PLPLHPD*SRFRSSNVYPMIDCSFY-PMSSLELYRNLLCRTSQSLSIGLRLVQNSESAKF 235 PLPL+ D S VY +ID F+ P SL + +LL S ++S L + + + KF Sbjct: 56 PLPLNFDISVHLMPTVYTLIDYLFFSPPFSLSIGPSLLVYLSIAVSYMLWVEKCYQMNKF 115 >SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ubp21|Schizosaccharomyces pombe|chr 2|||Manual Length = 1129 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 282 DFGKFYKGDSYIILKTTSDKRNNLSWDIHYWIGSETSQDEAG 407 D F D +L TT KRN WD+ + ++D +G Sbjct: 606 DMTDFSASDDDPVLITTKIKRNANIWDLQKHLAGLLNRDTSG 647 >SPAC3A12.04c |||RNase P and RNase MRP subunit p30 |Schizosaccharomyces pombe|chr 1|||Manual Length = 235 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 613 LAFNLEHTFLGTRISHDV 560 L F L+HTF+G +S D+ Sbjct: 121 LPFYLKHTFMGLAVSRDI 138 >SPAC1687.20c |mis6||inner centromere protein Mis6|Schizosaccharomyces pombe|chr 1|||Manual Length = 672 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 121 PYGSNLLILKSHHYRIR 171 PY SNLL+L + HY ++ Sbjct: 148 PYISNLLVLLTKHYHVK 164 >SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1045 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 369 NVYPMIDCSFYPMSSLELYR 310 N+YP+ID S Y +S+ Y+ Sbjct: 954 NIYPVIDDSIYELSAASKYQ 973 >SPAC23H3.08c |bub3||mitotic spindle checkpoint protein Bub3|Schizosaccharomyces pombe|chr 1|||Manual Length = 320 Score = 25.0 bits (52), Expect = 9.5 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +3 Query: 180 TKARVHPAFANAGRQAGVEIWRIQNFEPVAVQSKDFGK--FYKGDSYIILKTTSDKRNNL 353 +K R+ F + +W ++ +PV + +D GK F IL +R NL Sbjct: 102 SKLRLENCFISGSWDKSFRVWDVRVKQPV--EGQDIGKKIFASSSRDNILVLGCSERENL 159 Query: 354 SWDI 365 +DI Sbjct: 160 VYDI 163 >SPAC12B10.13 |||CTLH domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 240 Score = 25.0 bits (52), Expect = 9.5 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -2 Query: 381 FRSSNVYPMIDCSFYPMSSLELYRNLLCRTSQSLSIGLRLVQN 253 F N+ P+ + ++SLEL +LLC S S L+ V N Sbjct: 140 FAHENLAPLAPSNQKFLNSLELTMSLLCFPPSSYSPALKNVLN 182 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 427 SASMTSSVERRYNTARLWATRVTTSYSTSHLHYNTWMG 540 + ++S + N L ++ + TSYS S + Y++W G Sbjct: 48 NTDLSSQFFEQTNNGSL-SSLIDTSYSNSQICYSSWQG 84 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,935,515 Number of Sequences: 5004 Number of extensions: 62436 Number of successful extensions: 224 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 224 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -