BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I21 (575 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 1.3 AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine p... 25 1.8 AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine p... 25 2.3 AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine p... 25 2.3 AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine p... 25 2.3 AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 5.4 AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 23 7.1 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 9.4 AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine p... 23 9.4 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.4 bits (53), Expect = 1.3 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +3 Query: 222 KSERAQRHRGPGYSYRLHKPSGCS--SWPGRVPAAASAQQR 338 +S +Q+HRGPG + P P +V AAA QQ+ Sbjct: 900 RSSSSQQHRGPGAAAATGPPPPTHRLEQPPQVVAAAPTQQQ 940 >AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 19 YILTEGPPAKKTSSTANATTGAANAIT 45 >AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAIT 43 >AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N IT Sbjct: 17 YILTEGPPAKKTSNTANATTGAANAIT 43 >AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 19 YILTEGPPAKKTSSTANATTGAANAVT 45 >AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G +N +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAANAVT 43 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 521 PERSRNMPPKPNT 483 P RSR +PP P T Sbjct: 1110 PPRSRRLPPSPRT 1122 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 23.0 bits (47), Expect = 7.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 262 RIVSINPVGAPHGQGGY 312 R V++NPV PHG G + Sbjct: 200 RGVAMNPVEHPHGGGNH 216 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.6 bits (46), Expect = 9.4 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 238 NGTVDQGTRIVSINPVGAPHGQGGYLQQRLPNNETRTALLGNYLLSEGKPGKV 396 N ++ G R + + A +G G + NN T + N LL+ G PG V Sbjct: 432 NASMSSGKRSTATHQ--AEYGGSGGASSSINNNNNVT-IPNNNLLTGGGPGTV 481 >AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 9.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 Query: 364 YLLSEGKPGKVIKVVAKKRIGGSNFIT 444 Y+L+EG P K A G ++ +T Sbjct: 17 YILTEGPPAKKTSSTANATTGAASAVT 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,177 Number of Sequences: 2352 Number of extensions: 16631 Number of successful extensions: 104 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -