BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I21 (575 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 25 0.71 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 3.8 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 5.0 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 5.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.0 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 6.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 6.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 6.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 6.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.7 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 24.6 bits (51), Expect = 0.71 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +1 Query: 193 YLGVNCEGIINLSVRNGT 246 YLG+ C+G+ ++ RN T Sbjct: 9 YLGITCQGVTDIHSRNLT 26 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 3.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 190 AMVQLRRPPRKRNPCPGTRAS*SYRKSYR 104 A ++L PR RNP PG++ + +S+R Sbjct: 46 ASLKLAFEPR-RNPGPGSKGPRDFPRSHR 73 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -2 Query: 286 PLGLWRRYEYPGPRCRCARSDLLYPR 209 P+G W + PR RC +PR Sbjct: 134 PMGPWISVQEQVPRFRCIGPPTPFPR 159 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +1 Query: 196 LGVNCEGIINLSVRNGT 246 LG+ C+GI +++VR + Sbjct: 11 LGIACQGITSVTVRENS 27 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 5.0 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 298 HEEHPLGLWRRYEYPGP 248 ++E G+W++ E+ GP Sbjct: 945 YKEGDAGIWQQQEFTGP 961 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 5.0 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 298 HEEHPLGLWRRYEYPGP 248 ++E G+W++ E+ GP Sbjct: 941 YKEGDAGIWQQQEFTGP 957 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 6.6 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 169 PPRKRNPCP 143 PPR++N CP Sbjct: 340 PPRRKNNCP 348 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 556 SRSPASRGTLRGRNEVGTCLLNPTL 482 SRSP SRG N T +L+ L Sbjct: 79 SRSPESRGRSNASNTSKTFILSEKL 103 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 556 SRSPASRGTLRGRNEVGTCLLNPTL 482 SRSP SRG N T +L+ L Sbjct: 79 SRSPESRGRSNASNTSKTFILSEKL 103 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 556 SRSPASRGTLRGRNEVGTCLLNPTL 482 SRSP SRG N T +L+ L Sbjct: 79 SRSPESRGRSNASNTSKTFILSEKL 103 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 556 SRSPASRGTLRGRNEVGTCLLNPTL 482 SRSP SRG N T +L+ L Sbjct: 79 SRSPESRGRSNASNTSKTFILSEKL 103 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 556 SRSPASRGTLRGRNEVGTCLLNPTL 482 SRSP SRG N T +L+ L Sbjct: 79 SRSPESRGRSNASNTSKTFILSEKL 103 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 556 SRSPASRGTLRGRNEVGTCLLNPTL 482 SRSP SRG N T +L+ L Sbjct: 79 SRSPESRGRSNASNTSKTFILSEKL 103 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 556 SRSPASRGTLRGRNEVGTCLLNPTL 482 SRSP SRG N T +L+ L Sbjct: 79 SRSPESRGRSNASNTSKTFILSEKL 103 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 556 SRSPASRGTLRGRNEVGTCLLNPTL 482 SRSP SRG N T +L+ L Sbjct: 79 SRSPESRGRSNASNTSKTFILSEKL 103 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 261 SYRLHKPSGCSSWPGRVPAAASAQ 332 SY+ GCSS G +AA AQ Sbjct: 886 SYKPASTPGCSSKNGEPTSAAFAQ 909 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -1 Query: 308 PPWP*GAPTGFMETIRVPWSTVPLRTLRFII 216 PP T +TIR+ W + PL +I Sbjct: 1084 PPHDTTCTTLTSQTIRISWMSPPLSAANGVI 1114 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,888 Number of Sequences: 438 Number of extensions: 4848 Number of successful extensions: 19 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -