BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I20 (617 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0405 - 17657678-17658110,17658219-17659663,17659708-17660076 27 9.0 09_04_0282 - 16367886-16368587,16369209-16369345,16369764-163698... 27 9.0 >10_08_0405 - 17657678-17658110,17658219-17659663,17659708-17660076 Length = 748 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 205 VLLFYYYYQFRCTVLYVNAPSEPPLGRAMGWGESCV 312 ++ Y++ +L VN + P R MGWG + V Sbjct: 398 IIFLYFFIDAVVDILIVNKDAAPLYCRIMGWGRTPV 433 >09_04_0282 - 16367886-16368587,16369209-16369345,16369764-16369899, 16370021-16370422 Length = 458 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -1 Query: 350 NSGRASRTSLTNHTQLSPHPIALPRGGSD-GAFTY 249 +S R S TSL++ LSP ++L GS+ AFTY Sbjct: 40 SSSRMSFTSLSSSGTLSPEDLSLTLSGSNLYAFTY 74 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,019,884 Number of Sequences: 37544 Number of extensions: 238621 Number of successful extensions: 703 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -