BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I19 (381 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0580 + 10884012-10884081,10884173-10884419,10884472-108847... 26 8.7 >09_02_0580 + 10884012-10884081,10884173-10884419,10884472-10884735, 10885630-10886093,10888326-10888396 Length = 371 Score = 26.2 bits (55), Expect = 8.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 281 RSSFTSITSNLKSIXGITLNIAXKVYLKEGPY 376 ++ F SI L+ G T VY+ +GPY Sbjct: 23 KAGFVSIDCGLEGTSGYTAEDTGIVYVSDGPY 54 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,707,757 Number of Sequences: 37544 Number of extensions: 109633 Number of successful extensions: 183 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 624784784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -