BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I18 (676 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81523-6|CAB04244.1| 2586|Caenorhabditis elegans Hypothetical pr... 30 1.7 Z99288-10|CAB16552.2| 338|Caenorhabditis elegans Hypothetical p... 28 7.0 Z81483-7|CAB03964.2| 338|Caenorhabditis elegans Hypothetical pr... 28 7.0 >Z81523-6|CAB04244.1| 2586|Caenorhabditis elegans Hypothetical protein F32H2.5 protein. Length = 2586 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +2 Query: 218 IGSLDLTNRQKLGAATAGVALDNVNGHGVSLTDTHIPGFGD 340 IG +DL+ LG A LDNV+ HG+ L P GD Sbjct: 1832 IGKVDLSQNSSLGMAKL---LDNVSVHGILLDSIMDPTVGD 1869 >Z99288-10|CAB16552.2| 338|Caenorhabditis elegans Hypothetical protein ZK262.11 protein. Length = 338 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -2 Query: 453 LKLGTLAISGIFLVA-KAFAVMSWXSLWKRFTLP 355 L+ TL I+GIF + SW LWK+F P Sbjct: 108 LQFVTLGITGIFENRFRIICKFSWVPLWKKFITP 141 >Z81483-7|CAB03964.2| 338|Caenorhabditis elegans Hypothetical protein C43D7.6 protein. Length = 338 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -2 Query: 453 LKLGTLAISGIFLVA-KAFAVMSWXSLWKRFTLP 355 L+ TL I+GIF + SW LWK+F P Sbjct: 108 LQFVTLGITGIFENRFRIICKFSWVPLWKKFITP 141 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,778,387 Number of Sequences: 27780 Number of extensions: 304017 Number of successful extensions: 768 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 768 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -