SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0003_I17
         (554 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_38826| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     28   4.5  

>SB_38826| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 505

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 11/43 (25%), Positives = 27/43 (62%)
 Frame = -3

Query: 144 WHQAARNENDHIVVNNTRPKYTKVKQVVLHELRRYIRRYISFV 16
           +H+  ++ NDH+ +  +  KYT+  +  L + +R++++ +S V
Sbjct: 80  YHKPGKSINDHLCIEESSTKYTQESE-ELDKRQRHLKKGVSSV 121


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,238,141
Number of Sequences: 59808
Number of extensions: 394053
Number of successful extensions: 919
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 871
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 919
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1288581898
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -