BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I16 (632 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 23 2.8 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 23 2.8 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.8 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 21 8.6 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 8.6 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 327 LIDVLLWHRADVPIQC*RFVEPSG 256 ++ + W +D+ +C RF+ P G Sbjct: 29 IVHLFEWKWSDIADECERFLAPKG 52 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 327 LIDVLLWHRADVPIQC*RFVEPSG 256 ++ + W +D+ +C RF+ P G Sbjct: 30 IVHLFEWKWSDIADECERFLAPKG 53 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 2.8 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +1 Query: 1 FNFLDRLFSSGSISPILEDPKSTFAMDVLKYLQLELRGGKNIYKLLDSINVLCQL 165 + F + G+I+P E PK +L L L + + ++ +I V+C L Sbjct: 1577 YEFATLTVTGGTIAPAREIPKEDTFQIILANLNLVVPVVAAVLVIIVAIIVICVL 1631 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 327 LIDVLLWHRADVPIQC*RFVEPSG 256 ++ + W +D+ C RF+ P G Sbjct: 30 IVHLFEWKWSDIADVCERFLAPKG 53 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 388 LSASNLIRHAPN 353 +SASNLI+ PN Sbjct: 311 MSASNLIQRTPN 322 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,952 Number of Sequences: 336 Number of extensions: 2873 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -