BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I16 (632 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1362 + 29571324-29571564,29571746-29571921,29571972-295722... 30 1.8 01_07_0010 + 40429613-40429677,40429702-40430015,40432150-40434386 27 9.4 >06_03_1362 + 29571324-29571564,29571746-29571921,29571972-29572251, 29572949-29573085,29573174-29573401 Length = 353 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +1 Query: 286 YGDVCSVPQQNIDQIITVLAEIDWERDVSDLRPIRNELCDLMNI 417 YG V VP++NID+++ L E D +R R +E D+ +I Sbjct: 276 YGKVSKVPEENIDRMVNELKERDEKRKAFSRRRKFHEDKDIDSI 319 >01_07_0010 + 40429613-40429677,40429702-40430015,40432150-40434386 Length = 871 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +2 Query: 71 SLWTY*STCSWNYAGGRIYINS*IQLTFC 157 + WTY +C ++ R Y+N + +FC Sbjct: 302 TFWTYCDSCQMSFQYSREYVNRNLACSFC 330 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,408,639 Number of Sequences: 37544 Number of extensions: 299809 Number of successful extensions: 630 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -