BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I16 (632 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60740.1 68416.m06795 tubulin folding cofactor D identical to... 61 5e-10 >At3g60740.1 68416.m06795 tubulin folding cofactor D identical to tubulin folding cofactor D GI:20514263 from [Arabidopsis thaliana] Length = 1254 Score = 61.3 bits (142), Expect = 5e-10 Identities = 39/136 (28%), Positives = 72/136 (52%) Frame = +1 Query: 10 LDRLFSSGSISPILEDPKSTFAMDVLKYLQLELRGGKNIYKLLDSINVLCQLIQVGGIVC 189 ++ LFSS I E +F V+ L +ELR K+ KL + +L + V + Sbjct: 1083 IEILFSS-KIFLNQESYTFSFYAGVMDSLAIELRASKDFTKLKAGLAILGYIASVSHFIS 1141 Query: 190 SKSLGQLVIYLCYADRYVRRCAAARLYEALTLYGDVCSVPQQNIDQIITVLAEIDWERDV 369 +K+ QL+ +L + +R+ AA ++Y AL G + V ++ ++++I +++E WE D+ Sbjct: 1142 TKAFSQLLSFLGHRYPMIRKAAAEQVYLALLQNGIL--VTEEKMEKVIEIISESCWEADM 1199 Query: 370 SDLRPIRNELCDLMNI 417 + R ELC+L + Sbjct: 1200 ETTKTQRLELCELAGL 1215 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,602,970 Number of Sequences: 28952 Number of extensions: 247139 Number of successful extensions: 531 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -