BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I14 (570 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 30 1.5 SB_38766| Best HMM Match : 7tm_1 (HMM E-Value=1e-07) 28 4.7 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 29.9 bits (64), Expect = 1.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 210 RGHHS*SVHYLTKDKCSHCAEL 275 +GHH S HY + C+HC+ L Sbjct: 238 KGHHFVSTHYTSTTFCNHCSNL 259 >SB_38766| Best HMM Match : 7tm_1 (HMM E-Value=1e-07) Length = 625 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -2 Query: 296 IQVFFLF*LGTMAALVLC*IMYRLRMMAPPIDENIRKAALGDL 168 + + FL GT+ L++ +++ +R M PI+ + AL DL Sbjct: 309 VALIFLLVFGTVCNLIVIALVWTMREMRKPINIMVSSMALSDL 351 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,278,261 Number of Sequences: 59808 Number of extensions: 266015 Number of successful extensions: 514 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -