BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I14 (570 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 25 1.7 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 25 1.7 AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding pr... 23 9.3 AJ697722-1|CAG26915.1| 119|Anopheles gambiae putative odorant-b... 23 9.3 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 322 YFAELTQTIMLTLLCYFLLFSSVISIVLFCVGVSY 426 YF E I+ +L L+++ + ++L+C G Y Sbjct: 202 YFEEEIYQIIYNVLVMCLMYTFPLIVILYCYGSIY 236 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 322 YFAELTQTIMLTLLCYFLLFSSVISIVLFCVGVSY 426 YF E I+ +L L+++ + ++L+C G Y Sbjct: 202 YFEEEIYQIIYNVLVMCLMYTFPLIVILYCYGSIY 236 >AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding protein AgamOBP27 protein. Length = 119 Score = 22.6 bits (46), Expect = 9.3 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 503 LYNPSTVPLNPNFCF*PLDISQIIY 429 +YN T + P +C D+ Q IY Sbjct: 84 VYNICTDNVTPTYCVTAFDVYQCIY 108 >AJ697722-1|CAG26915.1| 119|Anopheles gambiae putative odorant-binding protein OBPjj12 protein. Length = 119 Score = 22.6 bits (46), Expect = 9.3 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 503 LYNPSTVPLNPNFCF*PLDISQIIY 429 +YN T + P +C D+ Q IY Sbjct: 84 VYNICTDNVTPTYCVTAFDVYQCIY 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 535,201 Number of Sequences: 2352 Number of extensions: 9539 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -