BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I14 (570 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 25 0.53 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 1.6 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 6.5 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 8.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 8.6 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 21 8.6 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 21 8.6 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 21 8.6 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 21 8.6 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 8.6 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 8.6 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 25.0 bits (52), Expect = 0.53 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 72 DMIDTNDYDLENKSHVNRIKSALT 1 + + DYDLEN+ ++NR + L+ Sbjct: 7 ESFEITDYDLENEFNINRPRRKLS 30 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 1.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 140 ITCRDYQSYLDHL 178 + C DYQ++L HL Sbjct: 290 VICEDYQAFLKHL 302 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 334 LTQTIMLTLLCYFLLFSSVISIVLFCVGV 420 L +++ L L+F SV +L CV + Sbjct: 22 LLSVLLVGFLFLILIFLSVAGNILVCVAI 50 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +1 Query: 25 YMTLVFQIIVICINHIVKFYYIKNSLVIVE 114 Y +VF + +C N + Y+ S V+ + Sbjct: 407 YSRIVFPVCFVCFNLMYWIIYLHISDVVAD 436 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +1 Query: 25 YMTLVFQIIVICINHIVKFYYIKNSLVIVE 114 Y +VF + +C N + Y+ S V+ + Sbjct: 407 YSRIVFPVCFVCFNLMYWIIYLHISDVVAD 436 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 444 FSNYLFI*YSNTEQNN*NYRRKQ 376 +SNY Y+N NN NY++ Q Sbjct: 91 YSNYNN--YNNNNYNNNNYKKLQ 111 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 444 FSNYLFI*YSNTEQNN*NYRRKQ 376 +SNY Y+N NN NY++ Q Sbjct: 91 YSNYNN--YNNNNYNNNNYKKLQ 111 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 444 FSNYLFI*YSNTEQNN*NYRRKQ 376 +SNY Y+N NN NY++ Q Sbjct: 91 YSNYNN--YNNNNYNNNNYKKLQ 111 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 444 FSNYLFI*YSNTEQNN*NYRRKQ 376 +SNY Y+N NN NY++ Q Sbjct: 91 YSNYNN--YNNNNYNNNNYKKLQ 111 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 441 SNYLFI*YSNTEQNN*NYRRK 379 +NY + Y+N NN NY +K Sbjct: 92 NNYKYN-YNNNNYNNNNYNKK 111 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 441 SNYLFI*YSNTEQNN*NYRRK 379 +NY + Y+N NN NY +K Sbjct: 92 NNYKYN-YNNNNYNNNNYNKK 111 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,913 Number of Sequences: 438 Number of extensions: 3056 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -