BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I11 (573 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1348.05 |||membrane transporter|Schizosaccharomyces pombe|ch... 25 7.9 SPBPB2B2.16c |||MFS family membrane transporter |Schizosaccharom... 25 7.9 SPAC750.02c |||membrane transporter|Schizosaccharomyces pombe|ch... 25 7.9 >SPBC1348.05 |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 485 Score = 25.0 bits (52), Expect = 7.9 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +2 Query: 419 KKKLLFFTITSCSPGVARVFNLFNLFMSNIT*YFSF*IVLNL 544 K +++FT+ S PG+A + + F + S+I + F I+L L Sbjct: 167 KYMVIYFTVLSIGPGIAPIISGF-ISQSSIGWQWEFWILLIL 207 >SPBPB2B2.16c |||MFS family membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 485 Score = 25.0 bits (52), Expect = 7.9 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +2 Query: 419 KKKLLFFTITSCSPGVARVFNLFNLFMSNIT*YFSF*IVLNL 544 K +++FT+ S PG+A + + F + S+I + F I+L L Sbjct: 167 KYMVIYFTVLSIGPGIAPIISGF-ISQSSIGWQWEFWILLIL 207 >SPAC750.02c |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 485 Score = 25.0 bits (52), Expect = 7.9 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +2 Query: 419 KKKLLFFTITSCSPGVARVFNLFNLFMSNIT*YFSF*IVLNL 544 K +++FT+ S PG+A + + F + S+I + F I+L L Sbjct: 167 KYMVIYFTVLSIGPGIAPIISGF-ISQSSIGWQWEFWILLIL 207 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,080,424 Number of Sequences: 5004 Number of extensions: 39533 Number of successful extensions: 78 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -