BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I11 (573 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11388| Best HMM Match : MFS_1 (HMM E-Value=0.0022) 29 3.6 SB_59775| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3e-08) 27 8.2 >SB_11388| Best HMM Match : MFS_1 (HMM E-Value=0.0022) Length = 720 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 74 FIKLNTYADSASSRGCGARFQGYAILHSFYCVLT*LLVQHKLKYD 208 F+ + + ++ CG FQ Y I F+C +T L + + +D Sbjct: 316 FLTVGVLLERSARTVCGDLFQDYVICFCFFCFMTVLTLVVTVNFD 360 >SB_59775| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3e-08) Length = 1381 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 299 NPLEVHYKIHINRQMSIRYYNF 234 N + +HYK + Q IRYY+F Sbjct: 948 NAINLHYKADLEVQEQIRYYDF 969 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,620,187 Number of Sequences: 59808 Number of extensions: 265497 Number of successful extensions: 483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -