BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I09 (520 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1343 - 26274788-26275019,26275972-26276611,26277174-262783... 31 0.55 08_02_0246 + 14745367-14745372,14745452-14746106,14746299-147472... 28 5.2 12_01_0731 - 6516894-6517473,6517485-6519574 27 9.0 12_01_0727 + 6446283-6449300 27 9.0 12_01_0715 - 6230393-6231559,6233234-6234553 27 9.0 07_03_1172 - 24521582-24521714,24522028-24522200,24522459-245226... 27 9.0 05_04_0451 - 21365617-21366279 27 9.0 >08_02_1343 - 26274788-26275019,26275972-26276611,26277174-26278367, 26278515-26278701 Length = 750 Score = 31.1 bits (67), Expect = 0.55 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = +2 Query: 263 RTNHRYRIVGFVD----NTYTGYRPNYRRTYTPNQNDGDECEISDIDEICTHV 409 R N RYR+VGFV+ + Y G+ Y R P Q +G D T V Sbjct: 678 RDNSRYRLVGFVEHLGPSMYAGHYVAYVRPSPPQQTNGSSSWFRASDTDITEV 730 >08_02_0246 + 14745367-14745372,14745452-14746106,14746299-14747269, 14748123-14749168,14750669-14751473 Length = 1160 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +2 Query: 272 HRYRIVGFVDNTYTGYRPNYRRTYTPNQNDGDECEISDIDEICTHVCGNACTESC*AS 445 HR +++ V N + ++ TP N +E + +I EIC + +E AS Sbjct: 902 HRVQLLLQVLNVKRFHHQQQQQQQTPQNNGQEELTVPEISEICDYFSRRVASEPYDAS 959 >12_01_0731 - 6516894-6517473,6517485-6519574 Length = 889 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +3 Query: 69 IRIRGTCQTLTRAIPAIILLTANNNRVKMSLPRPVVILGQLWLLIAIGQS 218 I +G+ T+++ + ++L+ +NN +PR + G+L LL A+ S Sbjct: 810 ISYKGSGLTISKTLRTLVLIDVSNNAFHGRIPRSI---GELVLLRALNMS 856 >12_01_0727 + 6446283-6449300 Length = 1005 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/55 (25%), Positives = 29/55 (52%) Frame = +3 Query: 69 IRIRGTCQTLTRAIPAIILLTANNNRVKMSLPRPVVILGQLWLLIAIGQSAAMPT 233 + +G T+++ + +++L+ +NN S+P + G+L LL + S M T Sbjct: 823 VTYKGNDMTISKILTSLVLIDVSNNEFHGSIPSNI---GELTLLHGLNMSHNMLT 874 >12_01_0715 - 6230393-6231559,6233234-6234553 Length = 828 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +3 Query: 69 IRIRGTCQTLTRAIPAIILLTANNNRVKMSLPRPVVILGQLWLLIAIGQS 218 I +G+ T+++ + ++L+ +NN +PR + G+L LL A+ S Sbjct: 749 ISYKGSGLTISKTLRTLVLIDVSNNAFHGRIPRSI---GELVLLRALNMS 795 >07_03_1172 - 24521582-24521714,24522028-24522200,24522459-24522677, 24523878-24524114,24524332-24524469 Length = 299 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 129 TANNNRVKMSLPRPVVILGQLWLLIAIGQ--SAAMPTEDATMVV 254 T RVK+ PR ++LGQ + LI + + + DAT ++ Sbjct: 97 TVRVTRVKLLKPRDALLLGQAYRLITVDEYKNTTEAAVDATRII 140 >05_04_0451 - 21365617-21366279 Length = 220 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 229 GIAAD*PMAINSHNWPSITTGLGSDILTLLLFAVNKMIAGIAL 101 G+A P+A N P + L ++ + LL V ++A +AL Sbjct: 30 GVAGALPVAENGRGGPLAVSSLNTNTIVLLALLVCGLVAAVAL 72 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,797,157 Number of Sequences: 37544 Number of extensions: 272397 Number of successful extensions: 675 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -