BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I08 (569 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1264 + 35321972-35322448,35323022-35323252,35323903-353245... 29 2.6 03_04_0161 + 17838466-17838551,17842379-17842445,17842537-178426... 28 4.6 03_01_0083 - 667530-667837,668092-668224 28 4.6 04_03_0588 + 17595299-17596151,17597519-17597665,17598562-175988... 27 8.0 >02_05_1264 + 35321972-35322448,35323022-35323252,35323903-35324565, 35324698-35324806,35324965-35325383 Length = 632 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -1 Query: 356 TIH*YTNLDFDLKNHFTTRPDVSLLKV*SQSNITASSTPYWIISGTTIFVI 204 T H N DF+L FT DVS + + + S+TP + SG +F + Sbjct: 564 TEHLQKNGDFNLLLSFTVEGDVSTKSIGFEPDTQMSTTPMVLRSGMYLFFV 614 >03_04_0161 + 17838466-17838551,17842379-17842445,17842537-17842662, 17842756-17842886,17843121-17843220,17843334-17843466, 17843500-17843544,17843545-17843608,17843692-17844469, 17844897-17845229,17845427-17845634,17845733-17845809, 17846168-17846240,17846343-17846413,17846597-17846716, 17846815-17846879,17846974-17847124 Length = 875 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +1 Query: 382 ILRGRVDLTYRASSDPLKMHRALRIIKTNTDISGDYTCV 498 I+ + LT S +PL M RALR KTN D+ ++ V Sbjct: 462 IVSDALRLTSGLSWEPLVMWRALREKKTNGDVEDEHFAV 500 >03_01_0083 - 667530-667837,668092-668224 Length = 146 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -2 Query: 196 HV*HGNR*QAEGLCIDASTTHGQPAFAP 113 HV HG A+ AST HG PA++P Sbjct: 35 HVEHGTTTSADDEYGSASTHHGMPAYSP 62 >04_03_0588 + 17595299-17596151,17597519-17597665,17598562-17598837, 17599108-17599805 Length = 657 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +1 Query: 190 IRGVKITKMVVPEIIQYGVEDAV 258 I+G IT++V PE+I+ +ED + Sbjct: 541 IKGKPITEIVAPEVIKEAIEDEI 563 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,316,355 Number of Sequences: 37544 Number of extensions: 306627 Number of successful extensions: 626 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 626 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -