BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I07 (596 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0649 - 18402976-18403220,18403305-18404499 46 2e-05 11_04_0234 + 15187065-15188241,15188316-15188494 41 7e-04 03_05_1021 - 29750155-29750220,29750342-29750428,29750614-297507... 29 2.8 07_01_0365 + 2718707-2718839,2719335-2719405,2719512-2719955,272... 29 3.7 10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 28 6.5 08_02_0969 - 23126389-23126670,23126764-23126947,23127017-231278... 28 6.5 12_02_0292 + 16979550-16980662,16983249-16983731 27 8.6 05_03_0191 - 9521496-9521921 27 8.6 >04_03_0649 - 18402976-18403220,18403305-18404499 Length = 479 Score = 46.4 bits (105), Expect = 2e-05 Identities = 33/115 (28%), Positives = 52/115 (45%), Gaps = 3/115 (2%) Frame = +1 Query: 49 DVPS--IINLVDIVNIQAFDYYTP-ERNPKEADYTAPIYAPQNRDPLQNADAAINYWIQN 219 D PS + +D VN+ AF P N + AP+Y +R +A + W+ Sbjct: 215 DYPSETVARSLDWVNVMAFGLRPPGAANANATAFDAPLY---DRASHYSASYGVVSWLDA 271 Query: 220 GAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEI 384 G P K+V+GI GR+W L + + P+ A + G + G +SY E+ Sbjct: 272 GVPASKVVMGIPLYGRSWFLRNKANSGVGAPVVAAGPKQRG--SNATGAMSYAEV 324 >11_04_0234 + 15187065-15188241,15188316-15188494 Length = 451 Score = 41.1 bits (92), Expect = 7e-04 Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 1/119 (0%) Frame = +1 Query: 31 NSSIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQNRDPLQNADAAINYW 210 ++++ + + + + +D VNI F + N AD AP+Y ++D +A + W Sbjct: 214 DTNLNYPIDDMSSSLDWVNIITFSLHK-NSNVTTAD--APLY---DKDSHFSASYGVISW 267 Query: 211 IQNGAPTHKLVLGISTTGRTWKL-DSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEI 384 + G P KLV+GI GR+W L + D G P A G + G+++Y EI Sbjct: 268 LDAGLPPCKLVMGIPLFGRSWFLRNKDKNGLGAPTAAA---GTKQRKSNQIGVIAYAEI 323 >03_05_1021 - 29750155-29750220,29750342-29750428,29750614-29750799, 29750965-29751059,29751179-29751284,29751378-29751452, 29751548-29751679,29751782-29751961,29752371-29752567, 29752651-29752906 Length = 459 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +1 Query: 238 LVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAK 393 LV+G + T L E+SG+P D GP K+ L++ E+ K Sbjct: 365 LVVGGWNSSNTSHLQEIGELSGIPSYWIDSEQRIGPGNKISYKLNHGELVEK 416 >07_01_0365 + 2718707-2718839,2719335-2719405,2719512-2719955, 2720660-2721802 Length = 596 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 173 ILYKTPTLL*ITGFKMVRLPTNLSLVSAPLDVRGSSI 283 ++Y +PT++ + GF + LSLV+A L+ GS + Sbjct: 293 VMYYSPTIVQLAGFASNQTALALSLVTAGLNAAGSLV 329 >10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 Length = 746 Score = 27.9 bits (59), Expect = 6.5 Identities = 22/93 (23%), Positives = 37/93 (39%) Frame = +1 Query: 184 NADAAINYWIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQG 363 N + +IN+W+ T G + + S + G A + G GP ++ Sbjct: 508 NGNGSINWWVNGARSTRDWASGEFVPKSSGAVSSTPSMRGTVCYVAPEYGGGGPLSERCD 567 Query: 364 LLSYPEICAKLINPNQNGKRPHLRKVNDPSKRF 462 + SY + LI +G+RP L+ P F Sbjct: 568 IYSYGVLLLVLI----SGRRP-LQVTASPMSEF 595 >08_02_0969 - 23126389-23126670,23126764-23126947,23127017-23127834, 23127953-23128642 Length = 657 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -1 Query: 590 MDTPPRFFVFT*LALFPAVSGSS*ETQKPPSPXSSGRRKA 471 M T P +A A GS +T PPSP GRR++ Sbjct: 542 MMTVPNLGTLDPMADADANDGSQMQTPAPPSPAGEGRRRS 581 >12_02_0292 + 16979550-16980662,16983249-16983731 Length = 531 Score = 27.5 bits (58), Expect = 8.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 231 PQTCPWYQHHWTYVEARFR 287 P+ W QHHWT R R Sbjct: 505 PEAKSWRQHHWTPARTRLR 523 >05_03_0191 - 9521496-9521921 Length = 141 Score = 27.5 bits (58), Expect = 8.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 219 WCAYPQTCPWYQHHWTYVEARFR 287 W P+ W++ HWT AR R Sbjct: 119 WQRRPEAEKWWRRHWTPARARLR 141 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.314 0.136 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,172,483 Number of Sequences: 37544 Number of extensions: 380747 Number of successful extensions: 818 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -