BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I04 (575 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 25 2.3 AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase pr... 25 2.3 AY745213-1|AAU93480.1| 171|Anopheles gambiae cytochrome P450 pr... 24 4.1 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 24 4.1 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 23 9.4 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 33 ARLAITLVHLKEFQGAVDSARKANSTRTWKEVCFA 137 A +TL+H+ + D + +ST T + C A Sbjct: 32 APFPLTLIHINDLHARFDETNQKSSTCTNSKECIA 66 >AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase protein. Length = 98 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 33 ARLAITLVHLKEFQGAVDSARKANSTRTWKEVCFA 137 A +TL+H+ + D + +ST T + C A Sbjct: 32 APFPLTLIHINDLHARFDETNQKSSTCTNSKECIA 66 >AY745213-1|AAU93480.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.8 bits (49), Expect = 4.1 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = +3 Query: 189 VVHADELEDLINYYQDRGHFDELISL 266 VV ADE +D+++Y + + D+L+++ Sbjct: 6 VVFADEEDDMLSYKKPQIFVDQLLTI 31 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.8 bits (49), Expect = 4.1 Identities = 14/60 (23%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = +3 Query: 225 YYQDRGHFDELISLLEAALGLERAHMGMFTELAILYSKYKPAK---MREHLELFWSRVNI 395 +Y+ GH D++ + + L +AH F ++I + + R L FW R + Sbjct: 401 FYRFHGHVDDVFDMHKQKLSPYKAHELSFPGVSISDATVQITSGKAARNRLLTFWQRTQV 460 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 22.6 bits (46), Expect = 9.4 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 317 LCEHAHVSSFQAQCRFQ 267 +C+ AH +SF + FQ Sbjct: 279 ICDEAHYASFNVRTNFQ 295 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,672 Number of Sequences: 2352 Number of extensions: 12176 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -