BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I03 (529 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pomb... 25 7.0 SPCC1494.08c |||conserved fungal protein|Schizosaccharomyces pom... 25 9.2 SPAC6B12.12 |tom70||mitochondrial TOM complex subunit Tom70|Schi... 25 9.2 >SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1095 Score = 25.0 bits (52), Expect = 7.0 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 237 FDVIIRLGF--YNWDEGNYFRTLDGQTLEAAGYAKWAKGQ 350 FD I+ L F +G FRTL G+T+E A A G+ Sbjct: 535 FDAIMPLLFNVLQQADGKEFRTLRGKTMECATLIALAVGK 574 >SPCC1494.08c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 274 Score = 24.6 bits (51), Expect = 9.2 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +1 Query: 334 NGQKDNRITSFLGKSRIAAACSGML 408 +G KD R++ LGK ++ + +G+L Sbjct: 143 SGNKDFRVSKTLGKPQVFSGLTGLL 167 >SPAC6B12.12 |tom70||mitochondrial TOM complex subunit Tom70|Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 24.6 bits (51), Expect = 9.2 Identities = 15/73 (20%), Positives = 28/73 (38%) Frame = +3 Query: 198 LFAQHPAQTLTVSFDVIIRLGFYNWDEGNYFRTLDGQTLEAAGYAKWAKGQPDNQFSRQK 377 L + P + SF F+ + + DG A Y KG+ + + K Sbjct: 274 LLKERPPKLPAASFIQTYLDSFHAQPKPLFDNKFDGDAALAEAYEYLEKGEYQLSYDKAK 333 Query: 378 QNCGGMFRDATLD 416 ++C G F +++ Sbjct: 334 ESCLGSFSSPSVN 346 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,064,972 Number of Sequences: 5004 Number of extensions: 37919 Number of successful extensions: 92 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 216376042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -