BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I03 (529 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74260.1 68414.m08600 AIR synthase-related family protein con... 30 1.1 At5g29624.1 68418.m03640 DC1 domain-containing protein contains ... 29 1.5 At5g54020.1 68418.m06719 expressed protein 29 1.9 At5g43400.1 68418.m05305 expressed protein strong similarity to ... 29 1.9 At1g71810.1 68414.m08299 ABC1 family protein contains Pfam domai... 29 1.9 At1g78800.1 68414.m09184 glycosyl transferase family 1 protein c... 28 3.4 At1g52310.1 68414.m05902 protein kinase family protein / C-type ... 28 3.4 At5g54050.1 68418.m06722 DC1 domain-containing protein 28 4.5 At1g08810.2 68414.m00980 myb family transcription factor (MYB60) 27 5.9 At1g08810.1 68414.m00981 myb family transcription factor (MYB60) 27 5.9 At4g14980.1 68417.m02302 DC1 domain-containing protein contains ... 27 7.8 >At1g74260.1 68414.m08600 AIR synthase-related family protein contains Pfam profiles: PF00586 AIR synthase related protein, N-terminal domain, PF02769 AIR synthase related protein, C-terminal domain Length = 1387 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 63 DQRTNKCYKFHSVGRPYSVAAAICSAEGGHLAII 164 D + Y F+ G P +AA ICS +G HLA++ Sbjct: 1312 DGNVTEAYPFNLNGSPLGIAA-ICSPDGRHLAMM 1344 >At5g29624.1 68418.m03640 DC1 domain-containing protein contains Pfam PF03107: DC1 domain Length = 488 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 360 QFSRQKQNCGGMFRDATLDDTLCDDHLAFI-CEKDPKKLQ 476 Q SR+ Q C D L+ T+CDD+ F+ C P+K++ Sbjct: 418 QSSRRCQACDREIHDDPLNCTVCDDYSLFMRCATLPRKVK 457 >At5g54020.1 68418.m06719 expressed protein Length = 556 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 360 QFSRQKQNCGGMFRDATLDDTLCDDH-LAFICEKDPKKLQ 476 Q SRQ Q CG L T+CDD+ L C P+K++ Sbjct: 406 QSSRQCQACGTKIDHDPLSCTVCDDYSLCMRCTTLPRKVK 445 >At5g43400.1 68418.m05305 expressed protein strong similarity to unknown protein (emb|CAB86628.1) Length = 655 Score = 29.1 bits (62), Expect = 1.9 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 2/76 (2%) Frame = +3 Query: 198 LFAQHPAQTLTVSFDVIIRLGFYNWDEGNYFRTLDGQTLEAAGYAKWAKG-QPDNQFSRQ 374 L+ HP +TL ++ ++ G++ FR L+GQ +E W K Q + R+ Sbjct: 128 LYKNHP-KTLALNVPALVDFGYFKDLPEILFRILEGQNMERGKNRVWRKRVQRKFKGKRE 186 Query: 375 KQN-CGGMFRDATLDD 419 K++ G D L++ Sbjct: 187 KKSEISGEMEDRILEN 202 >At1g71810.1 68414.m08299 ABC1 family protein contains Pfam domain, PF03109: ABC1 family Length = 692 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = +3 Query: 234 SFDVIIRLGFYNWDE--GNYFRTLDGQ 308 SF+ ++ GFY+ D GN+ RT DGQ Sbjct: 330 SFNQLLEYGFYHADPHPGNFLRTYDGQ 356 >At1g78800.1 68414.m09184 glycosyl transferase family 1 protein contains similarity to glycosyltransferase GI:871530 from [Saccharomyces cerevisiae], Alg2 mannosyltransferase [gi:3868942] from Rhizomucor pusillus; contains Pfam profile: PF00534 Glycosyl transferases group 1 Length = 403 Score = 28.3 bits (60), Expect = 3.4 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = -3 Query: 287 IVALVPIVETQSNYNIKRDGEGLSGMLCEQVPQDLGFCFT--IDDGQVAALR*ADRRRNG 114 + A P++ S ++ G++G LCE P+D I++ ++A R RN Sbjct: 317 MAAYKPVIACNSGGPVETVKNGVTGYLCEPTPEDFSSAMARFIENPELAN-RMGAEARNH 375 Query: 113 IRSSYAMK 90 + S+++K Sbjct: 376 VVESFSVK 383 >At1g52310.1 68414.m05902 protein kinase family protein / C-type lectin domain-containing protein contains protein kinase domain, Pfam:PF00069, PF00059 Lectin C-type domain Length = 552 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +3 Query: 78 KCYKFHSVGRPYSVAAAICSAEGGHLAIINSETEAEVLRNL 200 KCY + + + C GGHLA + S E ++ L Sbjct: 62 KCYAYFKNSTSWEKSEMFCRTYGGHLASLASSKELSFVQKL 102 >At5g54050.1 68418.m06722 DC1 domain-containing protein Length = 580 Score = 27.9 bits (59), Expect = 4.5 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 360 QFSRQKQNCGGMFRDATLDDTLCDDH-LAFICEKDPKKLQ 476 Q SR+ Q C +D L+ T+CD++ L C P+K++ Sbjct: 429 QSSRRCQACNKEIKDDPLNCTVCDEYSLCMRCATLPRKVK 468 >At1g08810.2 68414.m00980 myb family transcription factor (MYB60) Length = 197 Score = 27.5 bits (58), Expect = 5.9 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = +3 Query: 39 TTDKEYKMDQRTNKCYKFHSVGRPYSVAAAICSAEGGHLAIINSETE 179 TT E+KM RTN HS PY S E GH IN + + Sbjct: 89 TTFLEHKMQNRTNNFIDHHSDQFPYEQLQG--SWEEGHSKGINGDDD 133 >At1g08810.1 68414.m00981 myb family transcription factor (MYB60) Length = 280 Score = 27.5 bits (58), Expect = 5.9 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = +3 Query: 39 TTDKEYKMDQRTNKCYKFHSVGRPYSVAAAICSAEGGHLAIINSETE 179 TT E+KM RTN HS PY S E GH IN + + Sbjct: 172 TTFLEHKMQNRTNNFIDHHSDQFPYEQLQG--SWEEGHSKGINGDDD 216 >At4g14980.1 68417.m02302 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 470 Score = 27.1 bits (57), Expect = 7.8 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 366 SRQKQNCGGMFRDATLDDTLCDDH-LAFICEKDPKKLQ 476 S++ Q CG D L+ T+CDD+ L C P+K++ Sbjct: 319 SKRCQACGTETDDNLLNCTVCDDYALCMKCATLPRKVK 356 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,121,911 Number of Sequences: 28952 Number of extensions: 210047 Number of successful extensions: 506 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -