BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I02 (575 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 30 1.2 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 2.7 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 27 8.3 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 33.9 bits (74), Expect = 0.096 Identities = 18/62 (29%), Positives = 28/62 (45%) Frame = +1 Query: 376 ALDFYQTALRDPAFYQLYXRIVGYINAFKHYLKPYPQEKLHFVGVKIHDVVVEKLVTFFD 555 AL + ALR P ++Y + ++ FK LK YP H + + L+ + D Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEYID 239 Query: 556 YG 561 YG Sbjct: 240 YG 241 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.67 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 317 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 409 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 30.3 bits (65), Expect = 1.2 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 6/91 (6%) Frame = +2 Query: 296 NDLMKLLLAMCSVQHLN--HSTSTPSCPVRLTFTKP---HFETLHS-ISYXTGLWVTLTH 457 ++L L ++ HLN HST T S LT T H +S I++ T +TLTH Sbjct: 25 SNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 458 SSIT*SLILKRNFISSALKSMMLSLRN*SHS 550 ++T S + S L L+ +HS Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTLTHSTLTHS 115 Score = 29.5 bits (63), Expect = 2.1 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +2 Query: 341 LNHSTSTPSCPVRLTFTKPHFETLH-SISYXTGLWVTLTHSSIT*SLILKRNFISSALKS 517 L H T T S T T H H +++Y T TLTHS++T S + S + Sbjct: 62 LTHLTITYSTITHSTLT--HLTLTHLTLTYSTLTHSTLTHSTLTHSTLTHSTLTHSTITH 119 Query: 518 MMLSLRN*SH 547 L+ N +H Sbjct: 120 STLTHSNLTH 129 Score = 27.5 bits (58), Expect = 8.3 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 4/74 (5%) Frame = +2 Query: 341 LNHSTSTPSCPVRLTFTKP---HFETLH-SISYXTGLWVTLTHSSIT*SLILKRNFISSA 508 L H T T S LT T H H ++++ T + TLTHS++T S + S Sbjct: 52 LTHLTLTYSTLTHLTITYSTITHSTLTHLTLTHLTLTYSTLTHSTLTHSTLTHSTLTHST 111 Query: 509 LKSMMLSLRN*SHS 550 L ++ +HS Sbjct: 112 LTHSTITHSTLTHS 125 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (4%) Frame = +1 Query: 31 TGYYPLMT-SYYFPF--AQRPDNYNLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKK 201 T Y P T S Y Q+P+N++LH +A+ T L GKF+S G+ Sbjct: 4715 TSYQPAATDSLYISSQSTQKPNNHHLHRTCKADALEV----NVTLRGGLHAGKFKSVGRT 4770 Query: 202 IDFHD 216 D H+ Sbjct: 4771 RDVHE 4775 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -2 Query: 223 PFHRGNQFSCHTIRICLSVGTVRKSFQKCPRTVLL-RSSLRCVDC 92 P H NQ C IC+ G KS KCP L S RC C Sbjct: 245 PCHEANQGGCEGRAICVYTGP-GKSICKCPPGYKLDESQARCTLC 288 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 2.7 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +1 Query: 166 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 297 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 299 DLMKLLLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYXTG 436 ++ K+LL + + ++ S PV+L H ETL +SY G Sbjct: 264 EVAKVLLRSGAAESIHIENSNGKTPVQLAKESGHSETLELVSYDYG 309 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +1 Query: 181 FESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQRSYEIVAR 321 FE Y ++ DEKA ++ Y ++ A + E +RSY + + Sbjct: 138 FEIYVSLNEWQDEKAGQYLAVYLKDEAKAFYHEQEDSVRRSYRALCK 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,731,792 Number of Sequences: 59808 Number of extensions: 367492 Number of successful extensions: 1080 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1072 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -