BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_I01 (444 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 49 6e-08 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 49 9e-08 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 48 2e-07 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 46 8e-07 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 45 1e-06 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 44 2e-06 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 43 4e-06 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 43 4e-06 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 43 6e-06 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 41 2e-05 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 40 4e-05 AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 pr... 40 5e-05 AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 39 7e-05 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 39 7e-05 AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 pr... 38 1e-04 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 38 2e-04 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 38 2e-04 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 37 3e-04 AY745206-1|AAU93473.1| 91|Anopheles gambiae cytochrome P450 pr... 36 5e-04 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 36 5e-04 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 36 5e-04 AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 pr... 36 6e-04 AY745216-1|AAU93483.1| 89|Anopheles gambiae cytochrome P450 pr... 36 9e-04 AY745223-1|AAU93490.1| 83|Anopheles gambiae cytochrome P450 pr... 35 0.001 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 35 0.001 AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 pr... 33 0.003 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 33 0.003 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 32 0.011 AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CY... 32 0.011 AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 pr... 31 0.018 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 31 0.018 AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CY... 30 0.032 AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CY... 30 0.032 AY748830-1|AAV28178.1| 95|Anopheles gambiae cytochrome P450 pr... 30 0.042 AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 pr... 30 0.042 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 29 0.056 AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CY... 29 0.056 AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CY... 29 0.074 AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CY... 29 0.074 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 29 0.098 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 29 0.098 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 29 0.098 AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CY... 29 0.098 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 28 0.13 AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 28 0.13 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 28 0.17 AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CY... 28 0.17 AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 28 0.17 AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CY... 28 0.17 AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 pr... 27 0.23 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY745207-1|AAU93474.1| 103|Anopheles gambiae cytochrome P450 pr... 27 0.30 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 27 0.30 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 27 0.30 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 27 0.40 AY062203-1|AAL58564.1| 149|Anopheles gambiae cytochrome P450 CY... 26 0.52 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 25 1.2 AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 pr... 25 1.6 AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CY... 24 2.1 DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 23 4.9 DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 23 4.9 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 23 6.4 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 22 8.5 AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 pr... 22 8.5 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 8.5 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 49.2 bits (112), Expect = 6e-08 Identities = 20/39 (51%), Positives = 25/39 (64%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLP 433 PYT+LP GEGP C G+RFG + LVS++ F LP Sbjct: 441 PYTFLPFGEGPRVCIGMRFGMMQVKVGLVSMVRAFRFLP 479 Score = 28.7 bits (61), Expect = 0.098 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAI 176 L + +TLRK+PP+ RVA DY I Sbjct: 366 LGQVVNETLRKYPPLETTLRVAGQDYTI 393 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 48.8 bits (111), Expect = 9e-08 Identities = 22/49 (44%), Positives = 27/49 (55%) Frame = +2 Query: 287 FCPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLP 433 F P+ P YLP GEGP C GLRFG R L ++ +F+VLP Sbjct: 432 FTPERMARRDPCAYLPFGEGPRICIGLRFGMMQARIGLALLLKHFQVLP 480 Score = 28.7 bits (61), Expect = 0.098 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAI-DDKLTISGGTPV 212 +TLRK+PP+ ++R+ Y I D +T+ G + Sbjct: 373 ETLRKYPPVAILERIVTKPYRIPDTSVTLHPGMKI 407 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 47.6 bits (108), Expect = 2e-07 Identities = 20/49 (40%), Positives = 27/49 (55%) Frame = +2 Query: 287 FCPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLP 433 F P+ PY +LP GEGP C GLRFG + L++++ NF P Sbjct: 428 FLPEEVKKRHPYVFLPFGEGPRICIGLRFGVMQAKIGLITLLRNFRFTP 476 Score = 27.5 bits (58), Expect = 0.23 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAI 176 +TLRK+PP+ + RV DY + Sbjct: 369 ETLRKYPPIESLSRVPMRDYTV 390 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 45.6 bits (103), Expect = 8e-07 Identities = 22/63 (34%), Positives = 28/63 (44%) Frame = +2 Query: 245 PNSFQNLRNSILKDFCPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFE 424 P F N + F P+ + PY + P GEGP C GLRFG R L ++ F Sbjct: 407 PEVFPNPEQFDPERFSPEQEAKRHPYAWTPFGEGPRICVGLRFGMMQARIGLAYLLDGFR 466 Query: 425 VLP 433 P Sbjct: 467 FAP 469 Score = 27.9 bits (59), Expect = 0.17 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAI-DDKLTISGGTPVYCERH 227 L + ++LRK+PP+ RVA+ DY + K + GT V H Sbjct: 356 LDQILNESLRKYPPVPVHLRVASKDYHVPGTKSVLEAGTAVMIPVH 401 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 44.8 bits (101), Expect = 1e-06 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 P+ YLP GEGP C GLRFG R LV ++ +F Sbjct: 432 PFVYLPFGEGPRICIGLRFGMMQARIGLVYLLKHF 466 Score = 24.6 bits (51), Expect = 1.6 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAIDD-----KLTISGGTPVYCERH 227 +++RK+PP+ + R DY + D + I PVY H Sbjct: 363 ESMRKYPPITTLTRRVEKDYRVPDTDKVLQEGIMAAIPVYALHH 406 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 44.0 bits (99), Expect = 2e-06 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = +2 Query: 287 FCPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLP 433 F P+ P+T++P GEGP C GLRFG + L++++ F P Sbjct: 431 FLPEEVKKRHPFTFIPFGEGPRICIGLRFGLMQTKVGLITLLRKFRFSP 479 Score = 26.6 bits (56), Expect = 0.40 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAI 176 +TLRK+PP+ + RV + DY I Sbjct: 372 ETLRKYPPVESLTRVPSVDYLI 393 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 43.2 bits (97), Expect = 4e-06 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +2 Query: 287 FCPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLP 433 F P+ Y Y+P GEGP C GLRFG + L++++ F P Sbjct: 429 FRPEVANARPAYVYMPFGEGPRICIGLRFGMMQTKVGLITLLRQFRFSP 477 Score = 30.7 bits (66), Expect = 0.024 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 5/44 (11%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAIDDKL-TISGGT----PVYCERH 227 +TLRK+PP+ + R HDY + I GT P+Y H Sbjct: 370 ETLRKYPPLETVTRAPEHDYTVPGTAHVIPKGTMIQIPIYALHH 413 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 43.2 bits (97), Expect = 4e-06 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 PY YLP GEGP C G+RFG + L S++ F Sbjct: 434 PYCYLPFGEGPRVCIGMRFGSIQAKLGLASLLDRF 468 Score = 29.5 bits (63), Expect = 0.056 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGG----TPVYCERHGHA 236 L + ++TLRK PP+ ++R A DY + D L + G P+Y H A Sbjct: 359 LEQCISETLRKHPPVAILERNADKDYRLPDSGLLLRRGQKIMIPIYAMHHDPA 411 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 42.7 bits (96), Expect = 6e-06 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLP 433 PY + P GEGP C GLRFG R L +++ F P Sbjct: 371 PYAWTPFGEGPRICIGLRFGMMQARIGLAYLLTGFRFTP 409 Score = 23.0 bits (47), Expect = 4.9 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAI-DDKLTISGGTPVYCERH 227 L + ++LRK+PP+ R + +Y + K + GT V H Sbjct: 296 LDQILKESLRKYPPVPVHFRETSKEYQVPGTKTVLEAGTSVMVPVH 341 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 40.7 bits (91), Expect = 2e-05 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLP 433 P+ + P GEGP C GLRFG R L ++ F P Sbjct: 430 PFAWTPFGEGPRVCIGLRFGMMQARIGLAYLLQGFSFAP 468 Score = 27.9 bits (59), Expect = 0.17 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAI-DDKLTISGGTPVY 215 L + ++LRK+PP+ R+ A DY + D I GT ++ Sbjct: 355 LDQILKESLRKYPPVPMHFRMTAQDYRVPDTDSVIEAGTMLF 396 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 39.9 bits (89), Expect = 4e-05 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +2 Query: 320 YTYLPIGEGPTNCFGLRFGQQT*RFALVSIIS 415 + +LP G+GP NC G+RFG +F +V ++S Sbjct: 438 HAFLPFGDGPRNCIGMRFGLLEVKFGIVQMVS 469 Score = 23.4 bits (48), Expect = 3.7 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAID 179 L + +TLR +PP+ + RV Y ++ Sbjct: 362 LDQVINETLRMYPPVPQLIRVTTQPYKVE 390 >AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 protein. Length = 107 Score = 39.5 bits (88), Expect = 5e-05 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLPLP 439 PY +LP GP NC G +F + + ++ NF + P P Sbjct: 40 PYAFLPFSAGPRNCIGYKFAYIEMKTVIARVLQNFHLSPAP 80 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 39.1 bits (87), Expect = 7e-05 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV 427 PYTY+P G NC G +F Q + LV ++ F++ Sbjct: 115 PYTYIPFSAGSRNCIGQKFAQYELKSTLVKLLQRFQI 151 Score = 22.2 bits (45), Expect = 8.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHD 167 ++LR FPP+ I R+A D Sbjct: 47 ESLRLFPPVPVIARIATED 65 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 39.1 bits (87), Expect = 7e-05 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 320 YTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 ++YLP GEGP C G+RFG R L ++ N+ Sbjct: 430 FSYLPFGEGPRICIGMRFGLLQTRLGLAMLLRNY 463 Score = 23.4 bits (48), Expect = 3.7 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAIDDKLTISGGTPV 212 +TLR +PP+ + R+ Y + + + G V Sbjct: 362 ETLRLYPPVATLHRITTQPYQLPNGAILPEGVGV 395 >AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 38.3 bits (85), Expect = 1e-04 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +2 Query: 287 FCPKTKLVS*PYTYLPIGEGPTNCFGLRFG 376 F P+ PY +LP GEGP C GLRFG Sbjct: 54 FLPEEVKKRHPYVFLPFGEGPRICIGLRFG 83 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 37.9 bits (84), Expect = 2e-04 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFE 424 PYT+LP G GP C G R G+ R L ++S++E Sbjct: 426 PYTFLPFGAGPKICIGYRQGKLQLRTMLAVLLSSYE 461 Score = 22.2 bits (45), Expect = 8.5 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDKLTI 194 L + +TLRK P + RV DY + D I Sbjct: 350 LDQCINETLRKHPLAINLIRVVTEDYPVPDSTGI 383 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 37.5 bits (83), Expect = 2e-04 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 PY + P GEGP C G RFG R L+ ++++F Sbjct: 371 PYAWTPFGEGPRICVGPRFGLLQARIGLIYLLTSF 405 Score = 23.4 bits (48), Expect = 3.7 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 117 LRKFPPMGWIDRVAAHDYAIDDKLTI-SGGTPV 212 LRK PP+ R+ A DY + ++ GT V Sbjct: 304 LRKHPPISVHFRITAKDYIVPGTTSVLEAGTSV 336 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 37.1 bits (82), Expect = 3e-04 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 287 FCPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 F P+ PY+++P GEGP C RFG R L ++ +F Sbjct: 421 FAPEACESRKPYSFIPFGEGPRICIAARFGMLEARVGLAVLLMHF 465 >AY745206-1|AAU93473.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 36.3 bits (80), Expect = 5e-04 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFE 424 P Y P G GP NC GLR G + LV ++S F+ Sbjct: 43 PDAYYPFGLGPRNCIGLRQGIMLSKIGLVLMLSRFD 78 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 36.3 bits (80), Expect = 5e-04 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLP 433 PY Y+P G NC G R+ + A+V ++S + +LP Sbjct: 126 PYDYIPFSIGSRNCIGQRYALLEMKVAIVRMVSFYRILP 164 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 36.3 bits (80), Expect = 5e-04 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +2 Query: 326 YLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 Y P G GP NC GLR G + ALV ++S F Sbjct: 428 YYPFGAGPRNCIGLRQGLLLSKIALVMMLSRF 459 Score = 23.0 bits (47), Expect = 4.9 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAIDDKLTI 194 +TLR +P + ++R DY + D T+ Sbjct: 357 ETLRIYPALAVLNRECTIDYKVPDSDTV 384 >AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 35.9 bits (79), Expect = 6e-04 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 326 YLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV 427 Y P G+GP C G+RF R A+V ++ F + Sbjct: 56 YFPFGDGPRMCLGMRFAVTQVRRAIVEVVERFSI 89 >AY745216-1|AAU93483.1| 89|Anopheles gambiae cytochrome P450 protein. Length = 89 Score = 35.5 bits (78), Expect = 9e-04 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +2 Query: 284 DFCPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 +F P+ PY +LP GP NC G R+G + + L +++ + Sbjct: 35 NFLPERTAHRHPYCFLPFSAGPRNCIGYRYGLMSMKVMLCHLLAAY 80 >AY745223-1|AAU93490.1| 83|Anopheles gambiae cytochrome P450 protein. Length = 83 Score = 35.1 bits (77), Expect = 0.001 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 326 YLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV 427 +LP G+GP C G+RF + L +I+ +EV Sbjct: 28 FLPFGDGPRQCLGMRFALMQVKRGLFEVITKYEV 61 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 35.1 bits (77), Expect = 0.001 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAIDDKLTISGGT 206 +TLR +PP+ ++ RVA++DY ID TI GT Sbjct: 147 ETLRMYPPVDFLFRVASNDYPIDGFGTIPQGT 178 Score = 29.5 bits (63), Expect = 0.056 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 326 YLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 ++P G GP +C G FG + LV+++ +F Sbjct: 221 FMPFGLGPRHCIGDTFGLMLVKVGLVAMVRSF 252 >AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 protein. Length = 106 Score = 33.9 bits (74), Expect = 0.003 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 PY+YLP G +C G RF + LV ++S F Sbjct: 69 PYSYLPFSTGVRSCIGQRFAMLEMKTVLVRLLSRF 103 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 33.9 bits (74), Expect = 0.003 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRF 373 P TYLP G GP NC G RF Sbjct: 85 PGTYLPFGAGPRNCIGSRF 103 >AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 protein. Length = 102 Score = 33.5 bits (73), Expect = 0.003 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV-LPLPN 442 P+ Y+P G NC G +F + ALV I+ +V LP P+ Sbjct: 43 PFAYIPFSAGSRNCIGQKFALNELKTALVKILRQCKVELPDPD 85 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 33.5 bits (73), Expect = 0.003 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 326 YLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 Y P G GP NC GLR G + LV ++S + Sbjct: 428 YYPFGAGPRNCIGLRQGVFVSKIGLVLLLSKY 459 Score = 25.4 bits (53), Expect = 0.91 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAI-DDKLTISGGTPV 212 +TLRK+P + ++R DY + D + I GT V Sbjct: 357 ETLRKYPGLPILNRECTIDYKVPDSDVVIRKGTQV 391 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 31.9 bits (69), Expect = 0.011 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 290 CPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV 427 CP K V P+ YLP G G +C G R + ++ ++V Sbjct: 447 CPSAKEVH-PFVYLPFGFGARSCIGKRLAMMEMEILVCRMVRKYDV 491 >AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CYP4C28 protein. Length = 150 Score = 31.9 bits (69), Expect = 0.011 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +2 Query: 245 PNSFQNLRNSILKDFCPKTKLVS*PYTYLPIGEGPTNCFG 364 P F N F P+ PY+Y+P GP NC G Sbjct: 110 PQYFPNPEKFYPDRFLPENSTNRHPYSYIPFTAGPRNCIG 149 >AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 protein. Length = 99 Score = 31.1 bits (67), Expect = 0.018 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFG 376 P TY+P G GP C G FG Sbjct: 79 PCTYMPFGVGPRTCLGSHFG 98 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 31.1 bits (67), Expect = 0.018 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 326 YLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV 427 YLP G GP NC RF + + I+ N+E+ Sbjct: 465 YLPFGIGPRNCIASRFALMEVKAIVYHILLNYEL 498 Score = 26.2 bits (55), Expect = 0.52 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 108 TKTLRKFPPMGWIDRVAAHDYAI--DDKLTISGGTPVY 215 ++TLRK+ P DR+ DY I D + I G V+ Sbjct: 391 SETLRKWSPSPGTDRMCNQDYTIPGDPDIVIPKGATVF 428 >AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CYP4H17 protein. Length = 151 Score = 30.3 bits (65), Expect = 0.032 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +2 Query: 245 PNSFQNLRNSILKDFCPKTKLVS*PYTYLPIGEGPTNCFG 364 P F I + F ++ PY Y+P GP NC G Sbjct: 111 PKVFPEPEKFIPERFSDANEIKRGPYDYIPFSAGPRNCIG 150 >AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CYP4H16 protein. Length = 151 Score = 30.3 bits (65), Expect = 0.032 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +2 Query: 245 PNSFQNLRNSILKDFCPKTKLVS*PYTYLPIGEGPTNCFG 364 P F I + F ++ PY Y+P GP NC G Sbjct: 111 PEVFPEPEKFIPERFSEANEIPRGPYDYIPFSAGPRNCIG 150 >AY748830-1|AAV28178.1| 95|Anopheles gambiae cytochrome P450 protein. Length = 95 Score = 29.9 bits (64), Expect = 0.042 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFG 364 P TYLP G GP NC G Sbjct: 79 PNTYLPFGIGPRNCIG 94 Score = 27.9 bits (59), Expect = 0.17 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = +3 Query: 117 LRKFPPMGWIDRVAAHDYAIDD----KLTISGGTPVY 215 LR + P DR+ DY +DD K TI GT V+ Sbjct: 9 LRMWAPAPATDRLCVRDYVVDDGDRLKFTIDKGTVVF 45 >AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 29.9 bits (64), Expect = 0.042 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 287 FCPKTKLVS*PYTYLPIGEGPTNCFGL 367 F P K+ T+LP GEGP C G+ Sbjct: 60 FSPARKVTHEGATFLPFGEGPRMCLGM 86 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 29.5 bits (63), Expect = 0.056 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +2 Query: 290 CPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV 427 CP PY LP G G C G RF + + L + ++V Sbjct: 36 CPHAGQKIHPYVSLPFGYGRRTCIGRRFAECELQILLSKLFRRYQV 81 >AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CYP4J5 protein. Length = 153 Score = 29.5 bits (63), Expect = 0.056 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 287 FCPKTKLVS*PYTYLPIGEGPTNCFG 364 F P+ PY Y+P GP NC G Sbjct: 127 FLPECVSQRSPYAYIPFSAGPRNCIG 152 >AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CYP4C26 protein. Length = 154 Score = 29.1 bits (62), Expect = 0.074 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQ 379 PY Y+P GP NC G G+ Sbjct: 134 PYAYIPFTAGPRNCIGQSTGK 154 >AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CYP4D22 protein. Length = 151 Score = 29.1 bits (62), Expect = 0.074 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +2 Query: 287 FCP-KTKLVS*PYTYLPIGEGPTNCFG 364 F P +T S PY Y+P GP NC G Sbjct: 124 FAPDRTMEQSSPYAYVPFTAGPRNCIG 150 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 28.7 bits (61), Expect = 0.098 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV 427 P+ +LP G G +C G R + ++ +EV Sbjct: 456 PFIFLPFGFGARSCIGKRLAMMEMEIVIARLVRRYEV 492 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 28.7 bits (61), Expect = 0.098 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 287 FCPKTKLVS*PYTYLPIGEGPTNCFG 364 F P+ PY Y+P GP NC G Sbjct: 124 FLPENTENRHPYAYIPFTAGPRNCIG 149 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 28.7 bits (61), Expect = 0.098 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFG 364 PY Y+P GP NC G Sbjct: 135 PYQYIPFSAGPRNCIG 150 >AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CYP4H15 protein. Length = 151 Score = 28.7 bits (61), Expect = 0.098 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFG 364 PY+Y+P GP NC G Sbjct: 135 PYSYIPFTAGPRNCIG 150 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 28.3 bits (60), Expect = 0.13 Identities = 19/61 (31%), Positives = 27/61 (44%) Frame = +2 Query: 242 IPNSFQNLRNSILKDFCPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 IP + N R++ + P K V+ P+ +LP G G +C G R L I F Sbjct: 429 IPERWLNDRDASI----PSAKEVN-PFIFLPFGFGSRSCIGKRLAMMEMEVILARWIRQF 483 Query: 422 E 424 E Sbjct: 484 E 484 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 28.3 bits (60), Expect = 0.13 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFG 364 PY Y+P GP NC G Sbjct: 135 PYQYVPFSAGPRNCIG 150 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 27.9 bits (59), Expect = 0.17 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 323 TYLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 +YL G+GP C +RFG+ L ++ ++ Sbjct: 430 SYLAFGDGPRMCIAMRFGKLQTCLGLAMLLKSY 462 Score = 23.8 bits (49), Expect = 2.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAIDDKLTISGGTPV 212 +TLR +PP+ I R+ + Y + + I G V Sbjct: 361 ETLRLYPPVASIHRMTSQPYQLPNGEVIPEGVGV 394 >AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CYP4H14 protein. Length = 151 Score = 27.9 bits (59), Expect = 0.17 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFG 364 P+ YLP GP NC G Sbjct: 135 PFDYLPFSAGPRNCIG 150 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 27.9 bits (59), Expect = 0.17 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFG 364 PY Y+P GP NC G Sbjct: 135 PYDYIPFTAGPRNCIG 150 >AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CYP4D15 protein. Length = 151 Score = 27.9 bits (59), Expect = 0.17 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFG 364 PY Y+P GP NC G Sbjct: 135 PYQYIPFTAGPRNCIG 150 >AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 protein. Length = 159 Score = 27.5 bits (58), Expect = 0.23 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSII 412 P+ LP G NC GLR+ + + L+ ++ Sbjct: 126 PFALLPFSAGSRNCVGLRYAWISMKIMLLKVL 157 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 85 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 125 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 85 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 125 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 85 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 125 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 85 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 125 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 88 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 128 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 88 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 128 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 97 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 137 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 97 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 137 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 99 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 139 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 99 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 139 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 85 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 125 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 85 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 125 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 99 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 139 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 99 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 139 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 97 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 137 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 97 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 137 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 99 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 139 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 99 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 139 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 97 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 137 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 97 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 137 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 84 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 124 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 84 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 124 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 97 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 137 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 97 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 137 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 97 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 137 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 97 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 137 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 98 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 138 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 98 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 138 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 96 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 136 >AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 27.1 bits (57), Expect = 0.30 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +2 Query: 287 FCPKTKLVS*PYTYLPIGEGPTNCFGLRFGQQT*RFALVSII 412 F P+ P+ Y P G +C G R+ Q + LV ++ Sbjct: 62 FLPERSQGRHPHAYAPFSMGSRDCIGKRYAIQGMKLVLVHLL 103 >AY745207-1|AAU93474.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 27.1 bits (57), Expect = 0.30 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV 427 P+ LP G G C G RF + L ++ +F++ Sbjct: 67 PFASLPYGYGARMCLGRRFADLEMQILLAKLLRSFKL 103 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 27.1 bits (57), Expect = 0.30 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV 427 P+ +LP G G +C G R ++ FE+ Sbjct: 456 PFIFLPFGFGARSCIGRRLAMMELEMITARLVRQFEL 492 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 27.1 bits (57), Expect = 0.30 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 93 LSRHFTKTLRKFPPMGWIDRVAAHDYAIDDK-LTISGGTPV 212 L R +TLR FPP+ I R D + K TI GT V Sbjct: 60 LERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTV 100 Score = 25.8 bits (54), Expect = 0.69 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 320 YTYLPIGEGPTNCFG 364 Y+Y+P GP NC G Sbjct: 136 YSYIPFTAGPRNCIG 150 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 26.6 bits (56), Expect = 0.40 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 326 YLPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 Y P G GP NC G G + LV ++S F Sbjct: 428 YYPFGAGPRNCIGQ--GVLVSKIGLVFLLSKF 457 Score = 25.4 bits (53), Expect = 0.91 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAI-DDKLTISGGTPV 212 +TLRK+P + ++R DY + D + I GT V Sbjct: 357 ETLRKYPGLPILNRECTIDYKVPDSDVVIRKGTQV 391 >AY062203-1|AAL58564.1| 149|Anopheles gambiae cytochrome P450 CYP4C25 protein. Length = 149 Score = 26.2 bits (55), Expect = 0.52 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +2 Query: 245 PNSFQNLRNSILKDFCPKTKLVS*PYTYLPIGEGPTNCFG 364 P F N F P+ PY +P GP NC G Sbjct: 110 PEVFPNPDKFNPDHFLPENCRGRNPYAXIPFSAGPRNCIG 149 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 25.0 bits (52), Expect = 1.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 111 KTLRKFPPMGWIDRVAAHDYAIDD 182 +TLRK+ P ++DR Y ++D Sbjct: 389 ETLRKWTPAPFLDRTCTKPYMLED 412 Score = 24.2 bits (50), Expect = 2.1 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 329 LPIGEGPTNCFGLRFGQQT*RFALVSIISNF 421 L G GP NC G RF + ++++F Sbjct: 466 LAFGLGPRNCIGSRFALMETKAVFFFLLTHF 496 >AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 24.6 bits (51), Expect = 1.6 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEV 427 P LP G +C G + Q + L I++ FE+ Sbjct: 21 PSASLPFAIGARSCIGQKIAQLQMHYLLSMILTKFEL 57 >AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CYP4G16 protein. Length = 151 Score = 24.2 bits (50), Expect = 2.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 284 DFCPKTKLVS*PYTYLPIGEGPTNCFG 364 +F P+ + Y ++P GP NC G Sbjct: 124 NFLPEKQANRHYYAFVPFTAGPRNCIG 150 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 23.0 bits (47), Expect = 4.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 326 YLPIGEGPTNCFGLRFGQQT*RFALVSII 412 ++P G NC G R+ + + L SI+ Sbjct: 200 FIPFSAGSRNCIGGRYAMLSMKVMLSSIL 228 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 23.0 bits (47), Expect = 4.9 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +2 Query: 326 YLPIGEGPTNCFGLRFGQQ 382 ++P G NC G R+ Q Sbjct: 283 FMPFNTGSRNCIGSRYAMQ 301 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.6 bits (46), Expect = 6.4 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +2 Query: 329 LPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLPLP 439 +P G G C G F + L +++ NF + P Sbjct: 133 VPFGAGKRLCAGETFARNIMFLTLAALMQNFNIRQPP 169 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 22.2 bits (45), Expect = 8.5 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -3 Query: 343 FTNRQISVGLRYKLRFRAEI 284 FTN+++ G RY++ RA + Sbjct: 507 FTNKKLERGKRYRIFVRAVV 526 >AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 protein. Length = 155 Score = 22.2 bits (45), Expect = 8.5 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +2 Query: 317 PYTYLPIGEGPTNCFGLRFGQQT*RFALVSIISNFEVLPLPN 442 P Y P G G C G + L + + +F++L LP+ Sbjct: 108 PAQYHPFGVGKHRCMGELMAKSNLFLFLTTTLQSFDLL-LPD 148 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 8.5 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = -1 Query: 279 RIEFLRFWKEFGIPVHAHGVHNRQVYLRKW*VYRLSRSRERQLGQSSPSVEIFL 118 R F+ W+E G+ H ++NR + + S R R P +EI L Sbjct: 389 RCLFISHWQEEGVYWSLHYLYNRLRDISEETSALPSHPRRRSNSLPIPQIEISL 442 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 465,172 Number of Sequences: 2352 Number of extensions: 9433 Number of successful extensions: 164 Number of sequences better than 10.0: 117 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37418568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -