BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H24 (608 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38320.1 68415.m04708 expressed protein 29 2.4 At3g16620.1 68416.m02124 chloroplast outer membrane protein, put... 27 9.7 >At2g38320.1 68415.m04708 expressed protein Length = 410 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 358 MLDKTRKSKMDYVRQSVCNGPETFSVCCGPPPEINPEDMTLNERCSRAVTAFPLESN 528 +L++ R +M YV S+ G VC NP+ M ++ S +T LE N Sbjct: 120 LLERLRNKRMVYVGDSLNRGQWVSMVCMVSSVITNPKAMYMHNNGSNLITFKALEYN 176 >At3g16620.1 68416.m02124 chloroplast outer membrane protein, putative similar to chloroplast protein import component Toc159 [Pisum sativum] GI:8489806, chloroplast outer envelope protein 86 [Pisum sativum] GI:599958, GTP-binding protein [Pisum sativum] GI:576509 Length = 1089 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +1 Query: 412 NGPETFSVCCGPPPEINPEDMTLNERCSRAVTAFPLESNNECCGVEDTVVNK 567 N E F G + PE + + FPL SN+E C +E+T N+ Sbjct: 36 NEEEVFEEAIGSQEGLKPESL----KTDVLQEDFPLASNDEVCDLEETSRNE 83 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,088,320 Number of Sequences: 28952 Number of extensions: 262625 Number of successful extensions: 598 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -