BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H21 (241 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14870.1 68418.m01744 cyclic nucleotide-regulated ion channel... 29 0.57 At5g01310.1 68418.m00043 basic helix-loop-helix (bHLH) family pr... 27 1.7 At4g28470.1 68417.m04073 26S proteasome regulatory subunit, puta... 27 2.3 At3g45100.2 68416.m04868 N-acetylglucosaminyl-phosphatidylinosit... 26 4.0 At3g45100.1 68416.m04867 N-acetylglucosaminyl-phosphatidylinosit... 26 4.0 At3g23430.1 68416.m02953 phosphate transporter, putative (PHO1) ... 26 4.0 At5g03100.1 68418.m00258 F-box family protein contains F-box dom... 25 7.0 At2g35690.1 68415.m04377 acyl-CoA oxidase, putative strong simil... 25 7.0 At1g79220.1 68414.m09236 mitochondrial transcription termination... 25 7.0 At1g47390.1 68414.m05246 F-box family protein contains F-box dom... 25 7.0 At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyc... 25 9.3 At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyc... 25 9.3 At2g28320.1 68415.m03442 pleckstrin homology (PH) domain-contain... 25 9.3 >At5g14870.1 68418.m01744 cyclic nucleotide-regulated ion channel, putative (CNGC18) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc6) GI:4581207 from [Arabidopsis thaliana] Length = 706 Score = 28.7 bits (61), Expect = 0.57 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Frame = -1 Query: 220 WNHIYYLTDILLILCNKTIDFYMTCAGGATVAT*PQLQLLDIIVYFQR---LFS*SHLEE 50 WNH++ +T IL + + FY+ GG + + L + +F+ +F H+ Sbjct: 51 WNHVFLITSILALFLD-PFYFYVPYVGGPACLS-IDISLAATVTFFRTVADIFHLLHIFM 108 Query: 49 SPSTGFTLRSS 17 T F RSS Sbjct: 109 KFRTAFVARSS 119 >At5g01310.1 68418.m00043 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain, weak hit to PF01661: Appr-1-p processing enzyme family Length = 912 Score = 27.1 bits (57), Expect = 1.7 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 140 RSHGRDLTSTAAFRYNSLLPAIVLVVPLGGE-PVH 39 ++ G DL + R N+LLP +VVPL P+H Sbjct: 566 KAAGPDLETATRVRANTLLPGKAVVVPLPSTCPLH 600 >At4g28470.1 68417.m04073 26S proteasome regulatory subunit, putative contains Pfam domain PF01851: Proteasome/cyclosome repeat Length = 1103 Score = 26.6 bits (56), Expect = 2.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 208 YYLTDILLILCNKTIDFYMTCAGGATVAT*PQLQLL 101 YY D L+ C DF+++ G TV+T +L L+ Sbjct: 805 YYYKDASLLFCVTFYDFFLSFHGINTVSTYDRLVLI 840 >At3g45100.2 68416.m04868 N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein, putative similar to PIG-A from Mus musculus [gi:577723[, Homo sapiens [SP|P37287]; contains Pfam glycosyl transferase, group 1 family protein domain PF00534 Length = 447 Score = 25.8 bits (54), Expect = 4.0 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -1 Query: 238 FFF--FSGW-NHIYYLTDILLILCNKTI 164 FFF F G NHIYYL+ LL L +K + Sbjct: 15 FFFPNFGGVENHIYYLSQCLLKLGHKVV 42 >At3g45100.1 68416.m04867 N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein, putative similar to PIG-A from Mus musculus [gi:577723[, Homo sapiens [SP|P37287]; contains Pfam glycosyl transferase, group 1 family protein domain PF00534 Length = 447 Score = 25.8 bits (54), Expect = 4.0 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -1 Query: 238 FFF--FSGW-NHIYYLTDILLILCNKTI 164 FFF F G NHIYYL+ LL L +K + Sbjct: 15 FFFPNFGGVENHIYYLSQCLLKLGHKVV 42 >At3g23430.1 68416.m02953 phosphate transporter, putative (PHO1) identical to PHO1 protein [Arabidopsis thaliana] GI:20069032; supporting cDNA gi|20069031|gb|AF474076.1|; contains Pfam profiles PF03124: EXS family and PF03105: SPX domain Length = 782 Score = 25.8 bits (54), Expect = 4.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 130 PWLRPRTSCRNQLFYYIRL 186 PWLR RN+ FYY+ + Sbjct: 689 PWLRDNLVLRNKNFYYLSI 707 >At5g03100.1 68418.m00258 F-box family protein contains F-box domain Pfam:PF00646 Length = 307 Score = 25.0 bits (52), Expect = 7.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 220 WNHIYYLTDILLILCNK 170 W H++Y T + I+CN+ Sbjct: 41 WKHVWYETPSISIVCNR 57 >At2g35690.1 68415.m04377 acyl-CoA oxidase, putative strong similarity to acyl-CoA oxidase [Arabidopsis thaliana] GI:3044214 Length = 664 Score = 25.0 bits (52), Expect = 7.0 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 43 TGSPPSGTTRTIAGSKLLYLKAAVEVR-SRPWLRP 144 +G PSGTT + +K L L+ + VR +R WL P Sbjct: 447 SGKAPSGTTAYMGRAKHL-LQCSSGVRNARDWLNP 480 >At1g79220.1 68414.m09236 mitochondrial transcription termination factor family protein / mTERF family protein weak similarity to mtDBP protein [Paracentrotus lividus] GI:4584695; contains Pfam profile PF02536: mTERF Length = 399 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 124 SRPWLRPRTSCRNQLFYYI 180 SRP L PRT+ N+ F YI Sbjct: 208 SRPTLIPRTNFNNEKFEYI 226 >At1g47390.1 68414.m05246 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 25.0 bits (52), Expect = 7.0 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 33 NPVDGLSSKW---DYENNRWK*TIISKSCS*G 119 N +D S W D+ +N WK T + SCS G Sbjct: 154 NELDPTRSVWKIHDFASNSWKYTNLVMSCSSG 185 >At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 387 Score = 24.6 bits (51), Expect = 9.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 83 PAIVLVVPLGGEPVHRVHLEV 21 P + L V +GG+PV R+ +E+ Sbjct: 7 PNVFLDVSIGGDPVQRIVIEL 27 >At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 570 Score = 24.6 bits (51), Expect = 9.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 83 PAIVLVVPLGGEPVHRVHLEV 21 P + L V +GG+PV R+ +E+ Sbjct: 7 PNVFLDVSIGGDPVQRIVIEL 27 >At2g28320.1 68415.m03442 pleckstrin homology (PH) domain-containing protein / lipid-binding START domain-containing protein contains Pfam profiles PF01852: START domain, PF00169: PH domain Length = 737 Score = 24.6 bits (51), Expect = 9.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 74 QSLEVNYYI*KLQLRLGRDRGSA 142 Q+LE+NY+ K + LG D GS+ Sbjct: 659 QALEINYFRGKNYIELGVDIGSS 681 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,203,323 Number of Sequences: 28952 Number of extensions: 84339 Number of successful extensions: 180 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 180 length of database: 12,070,560 effective HSP length: 58 effective length of database: 10,391,344 effective search space used: 218218224 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -