BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H18 (592 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 27 0.12 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 1.5 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 5.9 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 27.1 bits (57), Expect = 0.12 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 290 FKRVILYKSFKYKKIVSQAIRPRFARCRLLII 385 FK+++ YK KY+K+ Q ++ R L ++ Sbjct: 513 FKKIVTYKGGKYRKVTFQCLKSIAWRAFLAVL 544 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 23.4 bits (48), Expect = 1.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 347 IRPRFARCRLLIIII*YVDNSFSL 418 +RP FA CRL ++ Y FSL Sbjct: 11 LRPIFAVCRLFALVPYYNFEKFSL 34 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 370 TTGKPGSNRLRH 335 T G P SNR+RH Sbjct: 78 TIGSPISNRIRH 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,462 Number of Sequences: 336 Number of extensions: 1933 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -