BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H18 (592 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26367| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_10386| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_26367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +2 Query: 305 LYKSFKYKKIVSQAIRPRFARCRLLIII--I*YVDNSFSLSIIAELDFDIH 451 +YK FKYK IV+ R A C +I + + + SF++S + D+H Sbjct: 128 IYKPFKYKVIVTSR---RVATCNAIIWVYSVLFTLTSFTMSREVFMQIDLH 175 >SB_10386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +3 Query: 168 LLISVQ*FIGNSEVKSPGTSVPRASLLSPRRGRLIPFHI 284 + +SV+ N E+ S G + PR ++ P + FH+ Sbjct: 519 MYVSVKLIGSNGELISKGRTTPRRHMIDPEYNEMFLFHV 557 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,037,101 Number of Sequences: 59808 Number of extensions: 221284 Number of successful extensions: 332 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 332 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -