BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H18 (592 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62550.1 68418.m07850 expressed protein 28 4.1 At2g07190.1 68415.m00824 hypothetical protein 27 7.1 >At5g62550.1 68418.m07850 expressed protein Length = 487 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 198 NSEVKSPGTSVPRASLLSPRRGRLIP 275 NS VKS +SV S + P+R R++P Sbjct: 91 NSSVKSVSSSVTSLSEVKPKRSRIVP 116 >At2g07190.1 68415.m00824 hypothetical protein Length = 452 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = -3 Query: 497 ITSTKEFITKVRFRDGVCQNLIQQ*YSRRNYYPH 396 + + +EF+ + RDG N+I++ SR+++ H Sbjct: 189 VINDREFVWRDEIRDGEVDNMIEKIKSRKDFRDH 222 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,854,582 Number of Sequences: 28952 Number of extensions: 150605 Number of successful extensions: 240 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 240 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -