BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H17 (556 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 24 1.0 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 23 2.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.1 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 9.5 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 23.8 bits (49), Expect = 1.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 363 QKQPESVKNVLRHMLTKSRRN 425 QKQ E+ + V+RH+ K R+ Sbjct: 79 QKQKETAEKVIRHLTQKRARD 99 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.6 bits (46), Expect = 2.4 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -3 Query: 152 AQIL*YQLEKECIQTHNFFQLNIGSVHLALERF*RLPVPF 33 +Q+L + E + +TH F LNI S + +E + P P+ Sbjct: 362 SQLLRHVEESDKQRTHQPFLLNIPSEGIKVEPRDKAPSPY 401 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 276 APAVNGLTPSDQVLRSAGVYD 214 AP N PSD+V+ ++ YD Sbjct: 1157 APQDNVSQPSDEVMENSWFYD 1177 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 276 APAVNGLTPSDQVLRSAGVYD 214 AP N PSD+V+ ++ YD Sbjct: 1157 APQDNVSQPSDEVMENSWFYD 1177 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 20.6 bits (41), Expect = 9.5 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 101 SYVSGYTPSQADIKVFEQVGKVPAASLPHVLRWYSHIASYT 223 S +GY S A + + K SLP ++ + S A Y+ Sbjct: 200 SIANGYAISCARYRFMPDIKKKGLHSLPRLVLFTSEDAHYS 240 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,284 Number of Sequences: 336 Number of extensions: 2191 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13725787 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -