BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H17 (556 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 32 0.015 AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-tran... 28 0.24 Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein prot... 27 0.41 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 24 3.9 AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-tran... 23 8.9 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 23 8.9 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 31.9 bits (69), Expect = 0.015 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +2 Query: 53 KTAQGLNELNQYLAERSYVSGYTPSQADIKVFEQ-----VGKVPAASLPHVLRWYSHIAS 217 K +G+ + YL + YV+G + AD +F + K + P+V RW++ + + Sbjct: 127 KVKRGVEIVEMYLTDSPYVAGQKLTIADFSIFVSFCSLDMMKYDLTAYPNVQRWFAKMGT 186 Query: 218 YTP 226 + P Sbjct: 187 HIP 189 >AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 27.9 bits (59), Expect = 0.24 Identities = 16/63 (25%), Positives = 25/63 (39%), Gaps = 5/63 (7%) Frame = +2 Query: 53 KTAQGLNELNQYLAERSYVSGYTPSQADIKVFEQVGKVPAASL-----PHVLRWYSHIAS 217 K + LN +L YV+G + + AD+ + + A HV WY +I Sbjct: 129 KMKDAVGFLNSFLDGHKYVAGDSLTIADLSILATISTYDVAGFDLAKYQHVAAWYENIRK 188 Query: 218 YTP 226 P Sbjct: 189 EAP 191 >Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein protein. Length = 209 Score = 27.1 bits (57), Expect = 0.41 Identities = 16/63 (25%), Positives = 26/63 (41%), Gaps = 5/63 (7%) Frame = +2 Query: 53 KTAQGLNELNQYLAERSYVSGYTPSQADIKVFEQVGKVPAASL-----PHVLRWYSHIAS 217 K ++ LN +L YV+G + + AD+ + + A HV WY +I Sbjct: 129 KMKDAVDFLNTFLDGHKYVAGDSLTIADLSILATISTYDVAGFDLAKYQHVAVWYENIRK 188 Query: 218 YTP 226 P Sbjct: 189 EAP 191 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.8 bits (49), Expect = 3.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 71 LALERF*RLPVPFFY*KF 18 +ALER+ L PFFY K+ Sbjct: 153 MALERYIALAKPFFYHKY 170 >AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-transferase D3 protein. Length = 210 Score = 22.6 bits (46), Expect = 8.9 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 5/63 (7%) Frame = +2 Query: 53 KTAQGLNELNQYLAERSYVSGYTPSQADIKVFEQVG-----KVPAASLPHVLRWYSHIAS 217 K + ++ L +L ERSY + + ADI + V K P + W + + Sbjct: 127 KLKKAMDLLEHFLTERSYAAADHLTVADICLLGSVTALNWLKYDLEPFPRIKAWVARVTG 186 Query: 218 YTP 226 P Sbjct: 187 EIP 189 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 22.6 bits (46), Expect = 8.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 175 QPTSCFEVVQPHRIVHPC*TQN 240 +P F +PHR+ +PC ++N Sbjct: 186 KPAFPFIQSEPHRLQNPCYSEN 207 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 501,025 Number of Sequences: 2352 Number of extensions: 8784 Number of successful extensions: 30 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -