BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H16 (505 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132865-13|CAB60609.1| 496|Caenorhabditis elegans Hypothetical... 29 2.5 Z54236-7|CAA90982.1| 1471|Caenorhabditis elegans Hypothetical pr... 28 3.3 >AL132865-13|CAB60609.1| 496|Caenorhabditis elegans Hypothetical protein Y62E10A.16 protein. Length = 496 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 7 RLLLFSTCSTMLKTLKPSTRVPLSLV 84 R+ F TCS +KT+K +PLS+V Sbjct: 290 RIEQFLTCSETIKTVKSDALIPLSIV 315 >Z54236-7|CAA90982.1| 1471|Caenorhabditis elegans Hypothetical protein C27B7.7 protein. Length = 1471 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/56 (23%), Positives = 29/56 (51%) Frame = +1 Query: 46 TLKPSTRVPLSLVCT*MRDSSCTHIILQLSSAMILMDSFYQLLMKFIHNSSLIWTL 213 T P T PLS+ CT ++ S ++ +++ + +DS + ++ +H + T+ Sbjct: 256 TADPQTNEPLSITCT-VKSVSKASVLWKVNGIKVSVDSSFYTVVTSVHEDFIESTI 310 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,374,701 Number of Sequences: 27780 Number of extensions: 230602 Number of successful extensions: 583 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 967231538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -