BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H15 (541 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 1.2 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 25 1.2 AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. 24 2.8 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 6.5 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 23 6.5 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 6.5 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 6.5 AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 23 8.7 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 25.4 bits (53), Expect = 1.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 115 NLILMKLKSST*DVLVEKSVLRPP 186 NL+L + DVL+ VLRPP Sbjct: 30 NLVLQAAREEKADVLILSDVLRPP 53 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 25.4 bits (53), Expect = 1.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 285 QLIVQNRQAQISVVPSAAALIIRALKEP 368 QL+ + RQ +++V PS+ L A K P Sbjct: 1610 QLLERTRQKRMAVCPSSVVLAREAFKHP 1637 >AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. Length = 93 Score = 24.2 bits (50), Expect = 2.8 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = -3 Query: 311 RLSVLHYQLDRDLETLPVTSGFSDVITNLFWGETKGTDFRSQGGRSTDFSTNTS 150 R+++ YQ E LP+ G+ +++ N KG ++ + S D S S Sbjct: 16 RINIAQYQHINYYEWLPIFLGWENMVKNRLIYRVKGGEYINDYDPSQDPSVLNS 69 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 6.5 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = +3 Query: 255 SDWKGLKITVQLIVQ---NRQAQISVVPSAAALIIR 353 S+WK T+QLI Q N+Q I++ + ++ R Sbjct: 168 SEWKSSTSTIQLIEQLDSNKQLAIALRTESKLMLFR 203 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 23.0 bits (47), Expect = 6.5 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +2 Query: 491 KRNPWHSTICWMHCG 535 ++ PW T+CW+ G Sbjct: 264 RQPPWCRTMCWIRSG 278 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.0 bits (47), Expect = 6.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +3 Query: 213 LSPKKVGDDIAKATSDW 263 L PKK+ D AK DW Sbjct: 200 LPPKKIKDPEAKKPEDW 216 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.0 bits (47), Expect = 6.5 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 408 GNITMEDVIGIAKIMRPRSMARYLSGSVKEIL 503 GN +M+ V IA++++P+ + ++ E+L Sbjct: 330 GNSSMKVVRQIAEMVKPKELRDLTDANITEVL 361 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 219 PKKVGDDIAKATSDWKGLKIT 281 PKK+ D++A D G+K+T Sbjct: 387 PKKLDDEVAALHLDKLGVKLT 407 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,100 Number of Sequences: 2352 Number of extensions: 11379 Number of successful extensions: 26 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -