BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H12 (628 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 26 0.35 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 1.8 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 5.6 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 21 7.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.4 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 25.8 bits (54), Expect = 0.35 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 85 TRPSFLKTGGSFFRPSSVVCG 23 + PS +TG S R SS++CG Sbjct: 336 SNPSITRTGLSSVRDSSIICG 356 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 247 SMAGTGPMPMMLGSTPTYDQPTNRASGFR 161 +M+G P+P M GS PT + A R Sbjct: 425 NMSGMPPLPNMPGSMPTMPTMPSMAGPIR 453 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 575 CTIIVSTSKLHVMSPH 622 CT+++ T KLH PH Sbjct: 438 CTVVIGTFKLH-RQPH 452 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 5.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 263 HQHDPQRYRPY 295 HQH P +Y P+ Sbjct: 319 HQHHPSQYHPH 329 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 21.4 bits (43), Expect = 7.4 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +2 Query: 65 FQEGRSRHRRQCIG 106 F+E S++R++CIG Sbjct: 32 FREMTSKYRKKCIG 45 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 7.4 Identities = 15/66 (22%), Positives = 25/66 (37%) Frame = -1 Query: 313 NATLISIRSISLRVMLVTLRRFSMAGTGPMPMMLGSTPTYDQPTNRASGFRFLAASSLAS 134 N S S S V+ +L+ F++ + M+ S YD+ L + + Sbjct: 245 NGKFFSRSSTSRIVISESLKHFTIQSSVTTSKMMVSPRLYDRQNGLVLSRMNLTLAKMEK 304 Query: 133 TRAPAP 116 T P P Sbjct: 305 TSKPLP 310 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,815 Number of Sequences: 438 Number of extensions: 3275 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -