BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H11 (463 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g35230.1 68418.m04177 hypothetical protein 29 1.2 At5g56980.1 68418.m07112 expressed protein non-consensus CG dono... 29 1.5 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 29 1.5 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 1.5 At1g73880.1 68414.m08556 UDP-glucoronosyl/UDP-glucosyl transfera... 27 4.7 At3g20720.1 68416.m02622 expressed protein 27 8.2 At3g02230.1 68416.m00204 reversibly glycosylated polypeptide-1 (... 27 8.2 At2g28240.1 68415.m03428 hydroxyproline-rich glycoprotein family... 27 8.2 At1g19020.1 68414.m02367 expressed protein 27 8.2 >At5g35230.1 68418.m04177 hypothetical protein Length = 366 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 253 GKGEIQDSAGQGSRKDSKEGLTQRVQGLGFRFQVG 357 G+G G+G + S EGL V+G GF G Sbjct: 99 GRGRAAPGRGRGREQPSHEGLVDEVEGEGFGADAG 133 >At5g56980.1 68418.m07112 expressed protein non-consensus CG donor splice site at exon 1, GA donor splice site at exon 3 Length = 379 Score = 29.1 bits (62), Expect = 1.5 Identities = 18/69 (26%), Positives = 31/69 (44%) Frame = -3 Query: 242 GHVRIPDYRHQILPDLVQIPDYHLQILPDPDQNLDHRCPGHRVLV*NLGCYLQIHPGLVH 63 GH P R + D V+ ++HL P P+ L H ++ +L Y +P + Sbjct: 50 GHAPAPLARAPSIIDRVKSINFHLYKFPHPETELFSMTAHHDIIGSDLHVYPDPNPAPLQ 109 Query: 62 RSQNLRNEV 36 R+ +L + V Sbjct: 110 RAPSLLDRV 118 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 29.1 bits (62), Expect = 1.5 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 261 GNSGFRG-PGFKEGFQRRVNPKGSRV-GIPVSSGRNMVGPWLVTNGGIP 401 G G G PGF+ F +P G + GIP S G + P+ + GGIP Sbjct: 121 GLPGIPGSPGFRLPFPFPSSPGGGSIPGIPGSPGFRLPFPFPPSGGGIP 169 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 301 NPSLNPGPRNPEFPPSQS 248 +PS N GP NPE PP QS Sbjct: 137 SPSPNVGPTNPESPPLQS 154 >At1g73880.1 68414.m08556 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 473 Score = 27.5 bits (58), Expect = 4.7 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = -1 Query: 439 FLHYINI*YPACFGIPPLVTNHGPTMFRPLETGIPTLEPFGLTLLWNPSLNPGPRN-PEF 263 F H + + A I LVT PL + + +EP L +PS+ G N + Sbjct: 32 FTHRLALRGGAALKITVLVTPKNLPFLSPLLSAVVNIEPLILPFPSHPSIPSGVENVQDL 91 Query: 262 PPS 254 PPS Sbjct: 92 PPS 94 >At3g20720.1 68416.m02622 expressed protein Length = 1083 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 294 EGFQRRVNPKGSRVGIPVSS 353 EGF + +PK SR G P SS Sbjct: 990 EGFDKMFSPKASRAGSPKSS 1009 >At3g02230.1 68416.m00204 reversibly glycosylated polypeptide-1 (RGP1) identical to reversibly glycosylated polypeptide-1 (AtRGP) [Arabidopsis thaliana] GI:2317729 Length = 357 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -1 Query: 400 GIPPLVTNHGPTMFRPLETGIPTLEPFGLTLLWNPSLNP 284 GIP NH P + L+ IPT+ +W P L P Sbjct: 9 GIP---VNHIPLLKDELDIVIPTIRNLDFLEMWRPFLQP 44 >At2g28240.1 68415.m03428 hydroxyproline-rich glycoprotein family protein Length = 660 Score = 26.6 bits (56), Expect = 8.2 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 394 PPLVTNHGPTMFRP 353 PPL++NH PT ++P Sbjct: 588 PPLISNHTPTSYQP 601 >At1g19020.1 68414.m02367 expressed protein Length = 86 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 214 WR*SGIRTWPGRIGKGEIQDSAGQGSRKDSKEGLTQRVQGL 336 W SG GRIG G + S+G G+ ++ + + QGL Sbjct: 10 WDNSGDSAKGGRIGSGAVVRSSGSGATSNTTKYKEKMGQGL 50 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,481,748 Number of Sequences: 28952 Number of extensions: 211052 Number of successful extensions: 564 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 772134480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -